Entry information : CgloCP01_Naragc5
Entry ID 13177
Creation 2015-04-23 (Christophe Dunand)
Last sequence changes 2015-04-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-04-23 (Christophe Dunand)
Peroxidase information: CgloCP01_Naragc5
Name CgloCP01_Naragc5
Class Catalase peroxidase    [Orthogroup: CP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum gloeosporioides (Glomerella cingulata)    [TaxId: 5457 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgloCP01_Naragc5
start..stop
S start..stop
CgloCP01_ST23 1444 0 1..764 1..778
CfioCP02_PJ7 1273 0 1..761 1..775
CfioCP02_MH18 1273 0 1..761 1..775
CgraCP02 1206 0 1..761 1..775
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..298 298 N° 2 359..492 134 N° 3 927..999 73 N° 4 1237..1668 432
N° 5 1780..1915 136 N° 6 2219..3440 1222  
join(1..298,359..492,927..999,1237..1668,1780..1915,2219..3440)


exon

Literature and cross-references CgloCP01_Naragc5
Literature Gan,P.H.P., Ikeda,K., Irieda,H., Narusaka,M., O'Connell,R.J., Narusaka,Y., Takano,Y., Kubo,Y. and Shirasu,K. Genome analysis of Colletotrichum orbiculare and Colletotrichum gloeosporioides
Protein sequence: CgloCP01_Naragc5
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   764 (743)
PWM (Da):   %s   81962.12 (79786.9)  
PI (pH):   %s   5.18 (5.05) Peptide Signal:   %s   cut: 22 range:22-764
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHAKLSNWLLTASTILPAVAGEGCPFAKRDGGVDSSLPKRATAEGFGRCSTISNQAGGGTRSHDWWPCQLRLDVLRQFQPATNPYGGDFDYTAAFNSLDYAALKKDLTDLMTDSQDWWPADFGHYGGLFIRLVAPAPIAPSTAAGQQRFAPLNSWPDNQNLDKARRLLWPIKQKYGNKISWADLYLLTGNVALESMGFAPIGFAGGRPDTWQSDESVYWGGETTFVPKGNDVRYNGSTDINERADKLEKPLGATHMGLIYVNPEGPDGSSDPAASAKDIRVAFDRMGMNDEETVALIAGGHAFGKTHGAVKSDNIGPEPEAADIGEMGLGWHNKVGDGNGPNQMTSGLEVVWTKTPTNLFCTTNGSxxxIPPVAHQWEAANGTLDYPDPFDSTKFRKATMLTSDLALINDPSYLNITKRWLDHPNELADAFAKAWFKLLHRDLGPVSRYLGPEIPKETFPWQDPLPAREGDLIDDADISQLKADILAAPGFDVSKYASVAWASASTYRHSDKRGGAHNGARIALEPQVNWVSNNPTQLKEVLDALRAIQTSFNTGAKKVSLADLIAGGVVAVEKGAKDAGVDVTVPFSAGRVDATQEQTDVRAFGYLQPQADGFRxxxxGTARARTEEILVDKAAQLTLSAPELTVLVGGLRSLGAVFDGSNTGVLTSTKGQLNNNFFVSLLDISTVWAKSAEDGEAWVGTDRKTKEQRWTATRADLVFGSHAELRAIAEVYAMSDAKEKFVKDFVAAWDKVMNLDRFDLKVKK

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). Incorrect prediction from NCBI (extra intron due to missing nucleotide
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACGCCAAACTGTCAAACTGGCTGTTGACAGCCTCAACCATCCTGCCGGCCGTCGCCGGTGAGGGATGCCCCTTCGCCAAACGCGACGGCGGCGTCGACAGCTCTCTGCCCAAGAGA
GCCACCGCCGAGGGCTTTGGAAGATGCTCGACCATCAGCAACCAGGCTGGCGGCGGCACTCGCAGTCACGACTGGTGGCCCTGCCAACTGAGACTCGACGTTCTTCGTCAGTTCCAGCCC
GCGACGAACCCGTACGGCGGCGACTTTGACTACACAGCAGCTTTCAACTCTCTTGATT
GTATGTTGAAGCTTCATCATGACTCTTGAGCAAAGAACACGACACTAACAAGGACCACAGAC
GCGGCTCTCAAGAAGGATCTCACCGACCTCATGACCGACTCCCAGGATTGGTGGCCTGCCGACTTTGGCCACTACGGCGGTCTCTTCATCCGCCTGGTAGCGCCGGCACCTATCGCGCCA
TCGACGGCCGCG
GTGGCGGTGGAATGGTAAGCCGTTTGTTTTCGGTCTTCTCTCCTTCGTCACCTCCTCGCTCTGCCCCCGCCCCGCCCTCCGATGAGCCCCGGATGGGCGCCCCATCTT
TCCTGATTCCAAATTCCCCTCTTGTGTGCCCCTGTCCGTTGTTTACATCGGACTTCGTTGGCTCATTTCACAAATTTTCACCTTCTGTGTTTCCTTCCTTTTTCTTGCCTCGCGCGGGAG
ATCAATTGGCTACCCGGAAGATTTCGTCCTATCCCGGACGAGAGCCAAGAGCTGCTAAGGCATCTCCTTGAGTCCTCTGCTCCACACGCACTGCACACAAGCGGACCCTGCCTCTGCCTC
TGCCTTGCATCTTATCACACGGTCGCATCACTTTTATTCGTCTCGTCCATCGCCGTTTACTAATATTGGATTTCTCTCTCTTGCAGGGCCAGCAACGCTTCGCTCCACTCAACTCCTGGC
CCGACAACCAGAACCTCGACAAGGCGCGCCGCCTGCTGT
GTAAGTCGCAAATCCCTGGTCCCTCACTCGCTGGCCGGAGCCACCCCCGAGGCGGGAATCCCTGTTCGTGCACATCATCGA
CTCACTCGCCACATCCGCCGCACGGGTGGCTGGGATGCGGATGTGGAGGCACAACGGGATGTCTCGCTGGTGGAGAAACTCTGGCCCCCGATGCTACTCTGTGATGAGTGCATTTGTTTG
CTCTACCGAGACTGACAATTTCATCTCCTCTGATAGGGCCCATCAAGCAAAAGTACGGCAACAAGATCTCATGGGCGGACCTGTACCTCCTGACGGGCAACGTCGCCCTCGAGTCCATGG
GTTTCGCGCCCATTGGCTTCGCCGGCGGTCGCCCCGACACCTGGCAGTCCGATGAGTCCGTCTACTGGGGCGGCGAGACGACCTTCGTCCCCAAGGGCAACGACGTCCGCTACAACGGCA
GCACCGACATCAACGAGCGCGCCGACAAGCTCGAGAAGCCTCTGGGAGCCACCCACATGGGCCTCATCTACGTCAACCCCGAGGGCCCCGATGGCTCTTCCGACCCCGCCGCCTCGGCCA
AGGACATCCGCGTCGCGTTCGACCGCATGGGTATGAACGATGAGGAGACGGTCGCTCTCATTGCCGGTGGACACGCCTTCGGCAAGACGCACGGTGCCGTCAAGAGTG
GTGAGTTTGCTC
TCTCTTCCCGTGCTCATTCCGGAGCTAGTGAAAGGCTGTTCCCACCGCTTCACCGCTCCTTTGTGCCGTGAGCATCTGCTGATGATTGAAATCCCACAGACAACATTGGCCCTGAGCCCG
AAGCTGCTGACATTGGCGAGATGGGCCTTGGCTGGCACAACAAGGTCGGCGATGGCAACGGTCCTAACCAGATGACCAGTGGTCTTGAGGTCGTCTGGACCAAGACCCCCACCAA
GTAAG
TGATGAAAAATGAAATGACCTCTGCATATCCCCCATGTCGGAGTTGCCTTTCCCCCTCTTCTTGGCTCAATATTTGAGGCCTTTTCTCATATGCCGGACCGGTCATTTTGAGAAGGTCTT
GAAGAGACGTTGAGAGAGACTTGCAGGGAGGCAAAAGAGGCGGCGTGAAAATCTATTTTTGGCCCCCGTCGGGTGATTATGTAGTGATACACACACATGCATACAACCACACACACACAC
ACGCACACACACAAATGCTAACCCATGTACCTGCAGGTGGTCCAACGGTTACTTGGAGTCTCTTCTGCACAACAAATGGGTCCTNNNNNNNNNNNCCGCCCGTTGCTCACCAATGGGAGG
CTGCCAACGGCACCCTCGACTACCCCGACCCCTTCGACTCGACCAAGTTCCGCAAGGCGACCATGCTCACCTCCGACCTGGCCCTCATCAACGACCCGAGCTACCTCAACATCACCAAGC
GCTGGCTCGACCACCCCAACGAGCTTGCTGACGCCTTCGCCAAGGCCTGGTTCAAGCTACTCCACCGCGACCTCGGCCCCGTCTCCCGCTACCTCGGCCCTGAGATCCCCAAGGAGACCT
TCCCCTGGCAGGACCCCCTCCCCGCCCGCGAGGGCGACCTCATCGACGATGCCGACATCTCGCAGTTGAAGGCTGACATCCTCGCCGCGCCGGGCTTCGACGTCTCCAAGTACGCCTCCG
TCGCCTGGGCCTCCGCCTCCACCTACCGCCACTCCGACAAGCGCGGCGGGGCCCACAACGGCGCTCGCATCGCCCTCGAGCCCCAGGTCAACTGGGTCTCCAACAACCCGACCCAGCTCA
AGGAGGTCCTCGACGCCCTCAGGGCCATCCAGACCAGCTTCAACACCGGCGCCAAGAAGGTCTCCCTCGCTGACCTGATCGCCGGCGGAGTCGTCGCCGTCGAGAAGGGCGCCAAGGACG
CCGGCGTCGACGTCACCGTCCCCTTCTCCGCCGGCCGTGTCGACGCTACCCAGGAGCAGACCGACGTCCGCGCCTTCGGCTACCTCCAGCCCCAGGCCGACGGCTTCCGCNNNNNNNCAA
TCGGCACCGCCCGCGCGCGCACCGAGGAGATCCTCGTCGACAAGGCCGCGCAGCTGACCCTCTCCGCCCCCGAGCTGACCGTCCTCGTCGGCGGTCTGCGCTCCCTCGGCGCCGTCTTCG
ACGGCTCCAACACCGGCGTCCTGACCTCGACCAAGGGCCAGCTCAACAACAACTTCTTCGTCAGCCTGCTCGACATCTCCACCGTCTGGGCCAAGAGCGCCGAGGACGGCGAGGCCTGGG
TTGGCACCGACCGCAAGACCAAGGAGCAGCGCTGGACCGCTACCCGCGCCGACCTCGTGTTCGGATCGCACGCCGAGCTGCGCGCCATTGCCGAGGTGTACGCCATGTCTGACGCCAAGG
AGAAGTTCGTCAAGGACTTCGTCGCGGCGTGGGACAAGGTCATGAACCTGGACCGCTTCGACCTCAAGGTCAAGAAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACGCCAAACTGTCAAACTGGCTGTTGACAGCCTCAACCATCCTGCCGGCCGTCGCCGGTGAGGGATGCCCCTTCGCCAAACGCGACGGCGGCGTCGACAGCTCTCTGCCCAAGAGA
GCCACCGCCGAGGGCTTTGGAAGATGCTCGACCATCAGCAACCAGGCTGGCGGCGGCACTCGCAGTCACGACTGGTGGCCCTGCCAACTGAGACTCGACGTTCTTCGTCAGTTCCAGCCC
GCGACGAACCCGTACGGCGGCGACTTTGACTACACAGCAGCTTTCAACTCTCTTGATT
ACGCGGCTCTCAAGAAGGATCTCACCGACCTCATGACCGACTCCCAGGATTGGTGGCCTGCC
GACTTTGGCCACTACGGCGGTCTCTTCATCCGCCTGGTAGCGCCGGCACCTATCGCGCCATCGACGGCCGCG
GGCCAGCAACGCTTCGCTCCACTCAACTCCTGGCCCGACAACCAGAAC
CTCGACAAGGCGCGCCGCCTGCTGT
GGCCCATCAAGCAAAAGTACGGCAACAAGATCTCATGGGCGGACCTGTACCTCCTGACGGGCAACGTCGCCCTCGAGTCCATGGGTTTCGCGCCC
ATTGGCTTCGCCGGCGGTCGCCCCGACACCTGGCAGTCCGATGAGTCCGTCTACTGGGGCGGCGAGACGACCTTCGTCCCCAAGGGCAACGACGTCCGCTACAACGGCAGCACCGACATC
AACGAGCGCGCCGACAAGCTCGAGAAGCCTCTGGGAGCCACCCACATGGGCCTCATCTACGTCAACCCCGAGGGCCCCGATGGCTCTTCCGACCCCGCCGCCTCGGCCAAGGACATCCGC
GTCGCGTTCGACCGCATGGGTATGAACGATGAGGAGACGGTCGCTCTCATTGCCGGTGGACACGCCTTCGGCAAGACGCACGGTGCCGTCAAGAGTG
ACAACATTGGCCCTGAGCCCGAA
GCTGCTGACATTGGCGAGATGGGCCTTGGCTGGCACAACAAGGTCGGCGATGGCAACGGTCCTAACCAGATGACCAGTGGTCTTGAGGTCGTCTGGACCAAGACCCCCACCAA
TCTCTTC
TGCACAACAAATGGGTCCTNNNNNNNNNNNCCGCCCGTTGCTCACCAATGGGAGGCTGCCAACGGCACCCTCGACTACCCCGACCCCTTCGACTCGACCAAGTTCCGCAAGGCGACCATG
CTCACCTCCGACCTGGCCCTCATCAACGACCCGAGCTACCTCAACATCACCAAGCGCTGGCTCGACCACCCCAACGAGCTTGCTGACGCCTTCGCCAAGGCCTGGTTCAAGCTACTCCAC
CGCGACCTCGGCCCCGTCTCCCGCTACCTCGGCCCTGAGATCCCCAAGGAGACCTTCCCCTGGCAGGACCCCCTCCCCGCCCGCGAGGGCGACCTCATCGACGATGCCGACATCTCGCAG
TTGAAGGCTGACATCCTCGCCGCGCCGGGCTTCGACGTCTCCAAGTACGCCTCCGTCGCCTGGGCCTCCGCCTCCACCTACCGCCACTCCGACAAGCGCGGCGGGGCCCACAACGGCGCT
CGCATCGCCCTCGAGCCCCAGGTCAACTGGGTCTCCAACAACCCGACCCAGCTCAAGGAGGTCCTCGACGCCCTCAGGGCCATCCAGACCAGCTTCAACACCGGCGCCAAGAAGGTCTCC
CTCGCTGACCTGATCGCCGGCGGAGTCGTCGCCGTCGAGAAGGGCGCCAAGGACGCCGGCGTCGACGTCACCGTCCCCTTCTCCGCCGGCCGTGTCGACGCTACCCAGGAGCAGACCGAC
GTCCGCGCCTTCGGCTACCTCCAGCCCCAGGCCGACGGCTTCCGCNNNNNNNCAATCGGCACCGCCCGCGCGCGCACCGAGGAGATCCTCGTCGACAAGGCCGCGCAGCTGACCCTCTCC
GCCCCCGAGCTGACCGTCCTCGTCGGCGGTCTGCGCTCCCTCGGCGCCGTCTTCGACGGCTCCAACACCGGCGTCCTGACCTCGACCAAGGGCCAGCTCAACAACAACTTCTTCGTCAGC
CTGCTCGACATCTCCACCGTCTGGGCCAAGAGCGCCGAGGACGGCGAGGCCTGGGTTGGCACCGACCGCAAGACCAAGGAGCAGCGCTGGACCGCTACCCGCGCCGACCTCGTGTTCGGA
TCGCACGCCGAGCTGCGCGCCATTGCCGAGGTGTACGCCATGTCTGACGCCAAGGAGAAGTTCGTCAAGGACTTCGTCGCGGCGTGGGACAAGGTCATGAACCTGGACCGCTTCGACCTC
AAGGTCAAGAAATAG

Retrieve as FASTA