Entry information : AalpPrx17
Entry ID 13188
Creation 2015-05-27 (Christophe Dunand)
Last sequence changes 2015-05-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-05-27 (Christophe Dunand)
Peroxidase information: AalpPrx17
Name AalpPrx17
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabis
Organism Arabis alpina    [TaxId: 50452 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AalpPrx17
start..stop
S start..stop
AtPrx17 613 0 6..328 3..326
AhalPrx10 612 0 6..330 3..328
AlyPrx17 612 0 6..328 3..326
BstrPrx75 604 0 7..328 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 30481218..30481427 210 N° 2 30480956..30481147 192 N° 3 30480285..30480878 594  
complement(join(30480285..30480878,30480956..30481147,30481218..30481427))


exon

Literature and cross-references AalpPrx17
DNA ref. GenBank:   CM002874.1 (30481427..30480285)
Protein sequence: AalpPrx17
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (309)
PWM (Da):   %s   37034.73 (34605.2) Transmb domain:   %s   i2-21o
PI (pH):   %s   5.31 (5.15) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLLLLLPHLIIYLLLLTVVTGEFLRPRFYSDSCPEAESIVRREMKKALIKEPRSVASVMRLQFHDCFVNGCDASVLLDDTPNMLGEKLSLSNINSLRSFEVVDDIKEALEKACPVTVSCADIVIMASRDAVALTGGPDWEVKLGRKDSLTASQQDSDDIMPSPRANATFLIDLFKRFHLSVKDMVALSGSHSIGQGRCFSVMFRLYNQSGSGKPDPALEPSYRRKLDKLCPLGGDENVTGDLDATPRLFDNQYFKDLVSGRGFLNSDQTLYTSRETREYVKMFSEDEAEFFRAFEEGMVKLGDLQSGRDGEIRFNCRVVNRKPIDVLREF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTTCTTCTTCTTCTTCCACATCTCATCATCTACCTACTACTCTTGACGGTGGTTACCGGTGAATTTCTCCGACCAAGATTCTACAGCGATTCATGCCCTGAAGCTGAATCCATT
GTACGAAGAGAAATGAAGAAAGCCTTGATCAAAGAACCAAGAAGCGTCGCTTCTGTCATGCGTCTCCAATTTCACGACTGTTTCGTCAAT
GTAAAGTTGTAAACTCAATAATCTTTCTCT
CTTCTTGATTTTCACTTTTTGTTTTCTTGAAATCTTTCAGGGATGTGACGCATCTGTGTTACTCGACGACACACCAAACATGCTCGGTGAAAAACTGTCACTTTCCAACATCAATTCACT
GAGATCTTTCGAAGTTGTTGACGACATTAAAGAAGCTTTAGAGAAAGCTTGTCCCGTTACTGTTTCTTGTGCCGATATCGTTATAATGGCTTCTCGTGACGCCGTTGCTCTG
GTAAATTT
CCAACTCAAAAACCCTTTTCTTGATTTCCCGGTTTAGTCGAATTTGTGATTCCGGTTTGATTGAACCAGACAGGAGGACCGGATTGGGAAGTGAAGCTAGGGAGGAAAGACAGTTTAACA
GCGAGTCAGCAAGATTCTGATGATATAATGCCGAGTCCAAGAGCAAACGCTACTTTCTTGATTGATTTGTTCAAAAGATTCCATCTTTCGGTTAAAGACATGGTGGCTTTATCAGGGTCA
CATTCTATTGGTCAAGGACGGTGTTTCTCGGTTATGTTCAGGCTTTATAACCAGTCTGGTTCTGGTAAACCGGATCCTGCTCTTGAACCGAGTTATAGGAGGAAGCTTGATAAGCTTTGT
CCTTTGGGTGGAGATGAGAATGTGACTGGTGATCTTGATGCAACGCCTCGGCTTTTTGATAATCAGTACTTTAAAGACTTGGTTTCAGGGAGAGGGTTTTTGAACTCGGATCAGACGTTG
TACACGAGTCGAGAGACGAGGGAGTATGTGAAGATGTTTAGTGAGGATGAAGCAGAGTTCTTTAGAGCGTTTGAAGAAGGGATGGTGAAGTTGGGTGATTTGCAATCTGGGAGAGATGGT
GAGATTAGGTTTAATTGTAGAGTTGTTAATAGAAAGCCTATTGATGTGTTGCGTGAGTTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTTCTTCTTCTTCTTCCACATCTCATCATCTACCTACTACTCTTGACGGTGGTTACCGGTGAATTTCTCCGACCAAGATTCTACAGCGATTCATGCCCTGAAGCTGAATCCATT
GTACGAAGAGAAATGAAGAAAGCCTTGATCAAAGAACCAAGAAGCGTCGCTTCTGTCATGCGTCTCCAATTTCACGACTGTTTCGTCAAT
GGATGTGACGCATCTGTGTTACTCGACGAC
ACACCAAACATGCTCGGTGAAAAACTGTCACTTTCCAACATCAATTCACTGAGATCTTTCGAAGTTGTTGACGACATTAAAGAAGCTTTAGAGAAAGCTTGTCCCGTTACTGTTTCTTGT
GCCGATATCGTTATAATGGCTTCTCGTGACGCCGTTGCTCTG
ACAGGAGGACCGGATTGGGAAGTGAAGCTAGGGAGGAAAGACAGTTTAACAGCGAGTCAGCAAGATTCTGATGATATA
ATGCCGAGTCCAAGAGCAAACGCTACTTTCTTGATTGATTTGTTCAAAAGATTCCATCTTTCGGTTAAAGACATGGTGGCTTTATCAGGGTCACATTCTATTGGTCAAGGACGGTGTTTC
TCGGTTATGTTCAGGCTTTATAACCAGTCTGGTTCTGGTAAACCGGATCCTGCTCTTGAACCGAGTTATAGGAGGAAGCTTGATAAGCTTTGTCCTTTGGGTGGAGATGAGAATGTGACT
GGTGATCTTGATGCAACGCCTCGGCTTTTTGATAATCAGTACTTTAAAGACTTGGTTTCAGGGAGAGGGTTTTTGAACTCGGATCAGACGTTGTACACGAGTCGAGAGACGAGGGAGTAT
GTGAAGATGTTTAGTGAGGATGAAGCAGAGTTCTTTAGAGCGTTTGAAGAAGGGATGGTGAAGTTGGGTGATTTGCAATCTGGGAGAGATGGTGAGATTAGGTTTAATTGTAGAGTTGTT
AATAGAAAGCCTATTGATGTGTTGCGTGAGTTTTGA

Retrieve as FASTA