Entry information : SpolPrx04 (Spipo8G0009900 [2.0] / Peroxidase39)
Entry ID 13190
Creation 2015-05-28 (Christophe Dunand)
Last sequence changes 2015-05-28 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-26 (Catherine Mathe)
Peroxidase information: SpolPrx04 (Spipo8G0009900 [2.0] / Peroxidase39)
Name (synonym) SpolPrx04 (Spipo8G0009900 [2.0] / Peroxidase39)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolPrx04
start..stop
S start..stop
PaPrx02 479 5e-172 1..328 1..325
ZmaPrx39 469 5e-168 4..328 11..340
VvPrx02 462 1e-165 10..328 9..325
PtPrx27 457 2e-163 15..328 14..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 970607..970819 213 N° 2 970966..971166 201 N° 3 971372..971534 163 N° 4 971647..972056 410
join(970607..970819,970966..971166,971372..971534,971647..972056)


exon

Literature and cross-references SpolPrx04 (Spipo8G0009900 [2.0] / Peroxidase39)
DNA ref. Phytozome 12:   pseudo8 (970607..972056)
Cluster/Prediction ref. Phytozome Gene 12:   31511527
Protein sequence: SpolPrx04 (Spipo8G0009900 [2.0] / Peroxidase39)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (304)
PWM (Da):   %s   35082.93 (32548.7) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.95 (8.91) Peptide Signal:   %s   cut: 25 range:25-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRMNSSMVIVVMGVLAIASCAQAQLRLGFYGQSCPNAEKIVLDYVKSRIPKAPSLAAALIRMHFHDCFVRGCDGSVLLNSTKTANASQTEKVSPPNLSVRGFGFIDGIKALVEKECPGVVSCADIVALAARDSVVTIGGPFWSVPTGRRDGTVSNFTEALFNLPPPTFNFANLTNVYASKGLNVTDLVLLSGAHTIGVSHCTSFSNRLYNFTGRGDQDPALDSNYAARLKQKCTSLADNVTLVEMDPGSVRTFDLGYYSLLLKRRGLFQSDAALTTNAAAKAFITNLVASPPQVFFQLFAGAMEKMGRIEVKTGSAGEIRRNCALVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nTCTCTCTCT CTCTCTCTCT CTCTCTCTCT CTCTCTCTCT CTCTCTCTCT GAATACATAC ACATGTACCA ATGAATGAAC TTTAGCTTCT TGGTGAAATT  TCAGAGTATT CGCGAGCTAA ATGACGTTAT AATGTAGTTT CCACGGAGAC TCGGACTAAA TTGATGAAGA TCTATCAGTA AAGTGACACG GAAGGCAGTT GAATTAATCT TGACCAGATA  TTTTATTAGA AAAACTCCAT CCCCACGTCA GAATCCCGCA AGGATGCTGC TCGGTGCCAG CTAGAATATT TGGTGGCTCG CGGGAAGATG GGGGGCGCCG AGAGGAGGGA CGTTGAGTTA  TTACTGTTGT TGATTCCATA TTTATCCTAG CAGGAGTAGT TGAGATGGAA CATGCAGAGA TCTACTCAAA TTCGAATTAG AATAAGATCG TTATGGTATT ATTTAAATCT CCACAAGAAA  AGTTGCAGTT TTTAATTTAG GACCTGGTCA GAAGATGGAA GTACTCGACG GCAAAGAGAT TCCTGCTGCT GCCGAGCACC GACGTGGGGA GGTCGTTCTA TAAATCATTC CCACCGAGGG  GATTCTTCTG AGCATCACAG AAACCGGTCG GGGGGAGAGA GAGGGAGACA GACCCAGGGC GAGAGTTGTT CATTGGGAAC ATGGGTAGGA TGAATTCGTC TATGGTGATC GTCGTGATGG  GTGTATTGGC CATTGCGAGC TGTGCCCAGG CTCAGCTTAG GCTCGGATTC TACGGCCAGA GCTGCCCCAA TGCCGAGAAG ATTGTTCTGG ACTACGTAAA AAGTCGCATA CCTAAAGCCC  CATCTCTCGC TGCTGCACTC ATCAGGATGC ACTTCCACGA CTGTTTCGTC AGGGTATGTA TTCAATTCTC TTCCTTCCTC CTGCCTTCCT CTCCCTCCTA CGTTTCTCCT CCTTTCTGTA  ATTTCTTCCT CCTTGCTCCT TTTCCTTCCT CTTCCACTGT TGTTGCTGCC GCTGAACTCG AGTGATCTCC ACGTCTCAGG GATGCGATGG TTCAGTCTTG CTCAACTCCA CGAAGACCGC  TAACGCAAGC CAGACGGAGA AAGTTTCGCC GCCGAACCTC AGCGTCCGCG GCTTCGGCTT CATCGACGGC ATCAAAGCCC TCGTCGAGAA GGAGTGCCCC GGTGTAGTCT CCTGCGCCGA  CATCGTTGCT CTGGCGGCCA GGGACTCCGT CGTAACCATA GTGAGTAGTC GGAACGTCTT CCATTGCAAT CTTTAACATT TTAGACTCAA CTTATCGAAG TCAACCTCCT TCTCAGTGCA  TATCACAAAC TATAATATGA AAAACAATAA AATATAATAC ATACAAACTT CTTGTACATA TAAGTTAATC CATTGATTAT GGGTTAATTA CCGCGATTCA AGGTGGTCTA ATTCTCTTCA  AACAGGGTGG CCCGTTTTGG AGCGTGCCGA CAGGGCGCAG GGACGGGACG GTCTCCAACT TCACCGAGGC CTTGTTTAAT CTCCCACCTC CCACCTTTAA CTTCGCGAAC CTTACCAATG  TCTACGCCAG CAAGGGCCTT AACGTCACCG ATCTCGTCCT CCTCTCCGGT GGGTTCTCCT CCTCATCTTC CTCCACTGTC GTCGTCGTCG TCGTCGTCAT CTTTCAAGAA GAAAGCTCTG  AATGAGGTCA CTAACAATCC CTCTGGTTTC GGCTCCTCAG GAGCTCACAC CATCGGGGTC AGCCACTGCA CCTCCTTCTC TAACCGCCTC TACAACTTCA CCGGGAGGGG CGACCAGGAC  CCTGCCCTTG ATAGCAACTA CGCGGCCAGA CTGAAGCAGA AATGCACCTC CCTCGCTGAC AACGTCACCC TCGTCGAGAT GGACCCAGGG AGCGTCAGGA CCTTTGACCT CGGCTACTAC  TCTCTCCTGC TCAAGAGGAG AGGACTCTTC CAGTCGGACG CCGCCCTCAC TACCAACGCC GCCGCGAAGG CCTTCATCAC TAATCTCGTC GCCAGCCCTC CCCAGGTCTT CTTCCAGCTA 
TTCGCCGGCG CCATGGAGAA GATGGGCCGG ATCGAAGTGA AGACCGGGTC AGCGGGTGAG ATCAGGAGGA ACTGCGCCCT GGTCAACTAA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAGGATGAATTCGTCTATGGTGATCGTCGTGATGGGTGTATTGGCCATTGCGAGCTGTGCCCAGGCTCAGCTTAGGCTCGGATTCTACGGCCAGAGCTGCCCCAATGCCGAGAAG
ATTGTTCTGGACTACGTAAAAAGTCGCATACCTAAAGCCCCATCTCTCGCTGCTGCACTCATCAGGATGCACTTCCACGACTGTTTCGTCAGG
GTATGTATTCAATTCTCTTCCTTCCTC
CTGCCTTCCTCTCCCTCCTACGTTTCTCCTCCTTTCTGTAATTTCTTCCTCCTTGCTCCTTTTCCTTCCTCTTCCACTGTTGTTGCTGCCGCTGAACTCGAGTGATCTCCACGTCTCAGG
GATGCGATGGTTCAGTCTTGCTCAACTCCACGAAGACCGCTAACGCAAGCCAGACGGAGAAAGTTTCGCCGCCGAACCTCAGCGTCCGCGGCTTCGGCTTCATCGACGGCATCAAAGCCC
TCGTCGAGAAGGAGTGCCCCGGTGTAGTCTCCTGCGCCGACATCGTTGCTCTGGCGGCCAGGGACTCCGTCGTAACCATA
GTGAGTAGTCGGAACGTCTTCCATTGCAATCTTTAACATT
TTAGACTCAACTTATCGAAGTCAACCTCCTTCTCAGTGCATATCACAAACTATAATATGAAAAACAATAAAATATAATACATACAAACTTCTTGTACATATAAGTTAATCCATTGATTAT
GGGTTAATTACCGCGATTCAAGGTGGTCTAATTCTCTTCAAACAGGGTGGCCCGTTTTGGAGCGTGCCGACAGGGCGCAGGGACGGGACGGTCTCCAACTTCACCGAGGCCTTGTTTAAT
CTCCCACCTCCCACCTTTAACTTCGCGAACCTTACCAATGTCTACGCCAGCAAGGGCCTTAACGTCACCGATCTCGTCCTCCTCTCCG
GTGGGTTCTCCTCCTCATCTTCCTCCACTGTC
GTCGTCGTCGTCGTCGTCATCTTTCAAGAAGAAAGCTCTGAATGAGGTCACTAACAATCCCTCTGGTTTCGGCTCCTCAGGAGCTCACACCATCGGGGTCAGCCACTGCACCTCCTTCTC
TAACCGCCTCTACAACTTCACCGGGAGGGGCGACCAGGACCCTGCCCTTGATAGCAACTACGCGGCCAGACTGAAGCAGAAATGCACCTCCCTCGCTGACAACGTCACCCTCGTCGAGAT
GGACCCAGGGAGCGTCAGGACCTTTGACCTCGGCTACTACTCTCTCCTGCTCAAGAGGAGAGGACTCTTCCAGTCGGACGCCGCCCTCACTACCAACGCCGCCGCGAAGGCCTTCATCAC
TAATCTCGTCGCCAGCCCTCCCCAGGTCTTCTTCCAGCTATTCGCCGGCGCCATGGAGAAGATGGGCCGGATCGAAGTGAAGACCGGGTCAGCGGGTGAGATCAGGAGGAACTGCGCCCT
GGTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAGGATGAATTCGTCTATGGTGATCGTCGTGATGGGTGTATTGGCCATTGCGAGCTGTGCCCAGGCTCAGCTTAGGCTCGGATTCTACGGCCAGAGCTGCCCCAATGCCGAGAAG
ATTGTTCTGGACTACGTAAAAAGTCGCATACCTAAAGCCCCATCTCTCGCTGCTGCACTCATCAGGATGCACTTCCACGACTGTTTCGTCAGG
GGATGCGATGGTTCAGTCTTGCTCAAC
TCCACGAAGACCGCTAACGCAAGCCAGACGGAGAAAGTTTCGCCGCCGAACCTCAGCGTCCGCGGCTTCGGCTTCATCGACGGCATCAAAGCCCTCGTCGAGAAGGAGTGCCCCGGTGTA
GTCTCCTGCGCCGACATCGTTGCTCTGGCGGCCAGGGACTCCGTCGTAACCATA
GGTGGCCCGTTTTGGAGCGTGCCGACAGGGCGCAGGGACGGGACGGTCTCCAACTTCACCGAGGCC
TTGTTTAATCTCCCACCTCCCACCTTTAACTTCGCGAACCTTACCAATGTCTACGCCAGCAAGGGCCTTAACGTCACCGATCTCGTCCTCCTCTCCG
GAGCTCACACCATCGGGGTCAGC
CACTGCACCTCCTTCTCTAACCGCCTCTACAACTTCACCGGGAGGGGCGACCAGGACCCTGCCCTTGATAGCAACTACGCGGCCAGACTGAAGCAGAAATGCACCTCCCTCGCTGACAAC
GTCACCCTCGTCGAGATGGACCCAGGGAGCGTCAGGACCTTTGACCTCGGCTACTACTCTCTCCTGCTCAAGAGGAGAGGACTCTTCCAGTCGGACGCCGCCCTCACTACCAACGCCGCC
GCGAAGGCCTTCATCACTAATCTCGTCGCCAGCCCTCCCCAGGTCTTCTTCCAGCTATTCGCCGGCGCCATGGAGAAGATGGGCCGGATCGAAGTGAAGACCGGGTCAGCGGGTGAGATC
AGGAGGAACTGCGCCCTGGTCAACTAA

Retrieve as FASTA