Entry information : SpolPrx06 (Spipo14G0024200 [2.0])
Entry ID 13193
Creation 2015-05-28 (Christophe Dunand)
Last sequence changes 2015-05-28 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-26 (Catherine Mathe)
Peroxidase information: SpolPrx06 (Spipo14G0024200 [2.0])
Name (synonym) SpolPrx06 (Spipo14G0024200 [2.0])
Class Class III peroxidase    [Orthogroup: Prx034]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolPrx06
start..stop
S start..stop
MguPrx13 471 5e-168 37..346 36..346
AcoPrx14 457 1e-162 33..346 32..346
VvPrx53 456 4e-162 41..346 38..345
CsPrx13 453 3e-161 15..346 20..354
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1434887..1435153 267 N° 2 1435222..1435422 201 N° 3 1436459..1437034 576  
join(1434887..1435153,1435222..1435422,1436459..1437034)


exon

Literature and cross-references SpolPrx06 (Spipo14G0024200 [2.0])
DNA ref. Phytozome 12:   pseudo14 (1434887..1437034)
Cluster/Prediction ref. Phytozome Gene 12:   31515710
Protein sequence: SpolPrx06 (Spipo14G0024200 [2.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (316)
PWM (Da):   %s   37741.14 (34439.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.07 (9.40) Peptide Signal:   %s   cut: 32 range:32-347
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASYPASASALSLGAAVLILFLLSNTWYAECYAAARKIPTRHPLSLDFYAKTCPQLDQFVASVTGQQFQTSPASGPATIRLFFHDCFVGGCDASILIAPGPRGSPPVERDMPENRNLAPEGFETINKAKALVESKCPGVVSCADILAIAARDFVHLAGGPYYAVKKGRRDSRVSQAAWVKFNLPRSNSTMDELISLFAKKGLSQEDLVALSGAHTIGFSHCHHFLGRLYDFQGTRRPDPVINPRLLKALQMSCPPYGGNTDVVAPFDVQTPFSFDHAYYGNLQSQMGLLLTDQALFLDPRTRPVVQALAKDKAKFFASFAAGMDKMGAFGVKKGRKGEHRTDCTRHS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGTAAGAGCA GTCTCCACAG CCTCCACTGT TTAGGTAGGT CGCTATGACA GACGGTGTAC ACCGTCTGAT GCCGGCGCAG TTATCGCAGT CAGCGGCAAT TTTCCGAGCG AATTTCCTCA  ACAATGGGGG TGGGATAGAC CAGGGGTTTA TCATAGGCCT CTTAAAGACA GGTAGGTTTG CAGTCTAGTC ATAGTAGGCT TGGTTTCCTT TGGCTCAGAC TTCAAAATCA AGCCCTTAAG  CCATTACTAG CAAACTGACA TTCTAAATGA GTCGGGTCTA TGCTCGGATA GTGCTCATAT CGGAAGCCCA GACCTCAGGA CCCGCACCTT CTATACTTTC ATCTTGTCGA AATATTTGTT  AATGCGACTC TTGATCAAAG GATAGCACAG TGAGAATAAG GGTAGTGCGA AAAAGATAGT CTCATAATGT TATTCGGAAT TTTCGATGAT TGACAATCCG AAACAGTTCC CACTCCGTTC  GCGCTCCCTC CACTACTAGC CCGCCAGCTT CCACCTCCAT CTGCCGGAGG CGTCCATCCT CTCCCCATCT GGTCACCTTC CTGCCTACTC TTCAAACGTC CACGTCAACC CTCCCCCTCA  TGACGGCCGT ACCAGGCAGC CCCTCCTACA CCCTCCCTCA GAGGCATTCC TCTCGGCGGG GGCCAAGTCC GAGCCCTGTA TAACACCAAA TAGTCTTGAG TTTGGAAATC TTCCATCCTG  ACTCAATAAC CTTTATAGCT AAGGATGGAA CTTAGTCTTC TAACTAATAA TAATAGTTAA AATTATTACA CGAGTTGGCC TGAAAGAGAA ATAGGGAAAG GATTTAAAAT TTAAAATATG  AAAGAAAAAT AACTGCGTGG CAAAACATTG TTGTACCAAG TCCTAATTAA TAACCTTATC TTAATATCTA AATAAGAAAT TTTTGGATCA GTCCCCGATT GAACTTGGTC TGACACACCG  ACTGATAGAT ACTAAACCTA TCAATGAATA AACCGCCGCA TGCCAATGGG TCCCGCGTAT GCCTAACACA CACGTACGTG CATTATCTTC TCACGAATAT TGATGATCGG CTGTTGTTCA  TCTAGGCCCA TCTGCAGCCC ATCTTCCAAG TTCTTTCGGG CCCCAGGTCT AAAGATTACA CAAGACCCAT TGACATCCGG AAGGCATGTT TGTTTATTTT TTTACCGATG TGATGCACGT  GTAACCTCTT TTTCTCGCCC AACCAAGTAC TCACATATTA ATTATTTAAA TAATCAGAAA GGCGCACCAA GTAATCAGAA AGAAATTTAA GTCGGTGAAT GGCGTGGCGC CTTCTAAGTG  TTCTCATGAG GCGTGCCATC CTACTGATGT ATACAAACTT TGTCGTATTA CAAAGATCAT CAGAGCATCC CATTATTCTT GAGAACCCTG GGAATTCTCG CGTCTCAGGC ATTAGCTTTC  CACTGAACGC CAACAAGACA GTGAATATCA TCTGTCTTTC TGAAATAACT GTTCCAGTAA AACAAGAGGG GCGAGGAACG TCGAATTCTG GAAGAAATAT TCTTTCTTCG TCACTTTGAT  CGGTCTCGAA TCTTTGAATT GATGCGTCGG TGGCCGTCTG CCAATGTTGC TGTTAATAAT CTTCCTACTT TTCGTGTCAA GTGAGGGAGA TCAGATGGCT AGTATCATGT AGATCAAGTT  GGGGCGAAGG TTCATTGCCC TGGCCGTCAG CTATCCTCCG GACAAGAACT CCGTCAAGGA CTGATGCAGA ATCGTGTAAA GATTTTCCTC TGCCAGGTAC CCCCCTCTCT ACAAATTTAA  AACCCTCACA ATAAAAACAA AAGCTTCTGC GGGGAGCTCT CTCTTTCTTC ACGGGTCTCT CTTTCTCTCT CTCTGCCTCT CTCTCTCTCT CTCTCTCTGC CCCCCCCCTT CGTGTGTACC  TATGGCTGGA GTGTTTTCTT TCACTAGCTT GCATTCTCCG TCCTTGGCCC TTGTGGCGTC CTCACTTCCG AGTGGCGAAA ATGGCGTCTT ATCCTGCTTC CGCCTCCGCC CTCAGCCTCG  GCGCCGCCGT TTTAATCCTC TTCCTCCTGA GCAACACATG GTACGCCGAG TGCTACGCTG CCGCGAGGAA GATCCCCACC CGCCACCCTC TCTCCCTTGA CTTCTATGCA AAGACATGCC  CGCAGCTCGA CCAATTCGTC GCCTCCGTAA CCGGCCAGCA GTTCCAGACC TCTCCCGCTT CCGGCCCCGC CACCATCCGC CTTTTCTTCC ATGACTGCTT CGTCGGGGTA AGCAAGACGA  CCTTCCTAGA GCTTCTCGGC GGCCATTAAT TCAGTCGCCG TTTGGGAACA TGCAGGGTTG TGATGCGTCG ATACTCATAG CGCCAGGTCC TCGAGGTTCT CCGCCGGTGG AGAGGGACAT  GCCAGAAAAC AGGAACCTGG CGCCAGAGGG CTTCGAGACG ATCAACAAGG CCAAGGCGCT GGTGGAGAGC AAGTGCCCGG GCGTGGTCTC CTGCGCCGAT ATCCTCGCCA TTGCAGCGAG  GGATTTCGTT CATCTGGTAT GCTCTCACTT AATATGATGA AGAAAAGCTT AAAAGTTCCC GTACGTTACA CATCTAATTA CCCATTTGCG CCATTTTTTC GCCGAAAGTC CCCAAATAGT  ACACTAATCT GCCTATTCAA CCGTTATTTT CGTGCAAAAA GACCATACGT GTTATATCGG TACCACGTAT GGCCGTCACT TTCTCTCCTC AAAAGTCCCA CCATAAATAA TACACCAATT  TCACGTACAT AGTTGCGTAA CCAATAAAAA TTAGACAGAT ATCTCTGGAT CGTCTTGTAG AATTTCGATC CGTCTCTGGT CTCTCTCGTC TTGCTCTCCA ACTCTCAACT CTCCCAAGAA  GCTTCCTCAA TGTCACCTTT CTCACCCACC CTCGCTCGCT AGGTTAATCT CTCATCACCA TGATCAGGCC GCATGAAAGG TCGAGAAATC TTATCTTTCC TTGTCCTTTC TTTGAAATAA  TGGTGGGGCA GCGCCAAAGC CGGCAGCATC CCTGACAGAC CTGCCGTCTT TCGTTGCCTT GTGTATTTAC TGTTGGTCTG CACGACCTTG CTGATCCTTG TCGGGAATCC AAACCACGTC  ATTTGAATAC GGAGGAAAAG GGCCTCGTTT TGTAGGACTA TGTTTTCTCT GTTGACTTCA CATGGGTCTT TAGTTTGTCT AGCGTCTGGA CATGGTAGTC ACGGTGGATC CCTGCAGGTA  GCAACTAGGC GGGGGGGTAG ACTAGTCCTC CATTAGAAGG CTCCATTTCT ATGTAACGTT AGTTAAAATA GTTTTCAAAT AAATTAATTG TGAACTATGG TAAAATACGG CAAGACAAGT  TGGTTCAATG AACATGCGTC GGTTTATACA TAAAAGTCAA AGCTTTTTTA AAGAATATCA TCGAATGGTG TAATAGCTGA AATAATATCT CGTGAAGTTG GCTGGAAGTA TTTAATTGTA  ACGAGTATGT GAAAACATGT CTCCGAATTG TTGATGAGGA GGCCCCGATT TGCACGTGAA TGGATTGTTT TGTCGGCACA TTGTGAATGC AGGCGGGGGG GCCCTACTAT GCCGTGAAGA  AGGGAAGAAG GGACAGCAGA GTCTCCCAAG CCGCCTGGGT GAAGTTCAAC CTACCCCGCT CCAACTCCAC CATGGACGAA CTCATCAGTC TCTTCGCGAA GAAGGGGCTG AGCCAGGAGG  ACCTGGTGGC GCTTTCCGGC GCCCACACCA TCGGTTTCTC CCATTGCCAC CATTTCCTTG GCCGGCTCTA CGACTTTCAG GGCACCAGGC GGCCCGACCC GGTCATCAAT CCGAGGCTCC  TCAAAGCCCT CCAGATGTCC TGCCCTCCCT ACGGCGGCAA CACTGACGTC GTCGCACCGT TCGACGTGCA GACGCCGTTC TCCTTCGACC ACGCGTACTA TGGCAACTTG CAGTCCCAGA  TGGGATTGCT GTTGACGGAC CAGGCGCTGT TCCTGGACCC GCGAACAAGA CCCGTCGTGC AGGCCTTGGC CAAGGACAAG GCCAAGTTCT TCGCGTCCTT TGCGGCGGGG ATGGACAAGA 
TGGGCGCGTT CGGGGTGAAG AAGGGGAGAA AGGGGGAGCA TAGAACGGAT TGTACGAGGC ACTCTTAG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTTATCCTGCTTCCGCCTCCGCCCTCAGCCTCGGCGCCGCCGTTTTAATCCTCTTCCTCCTGAGCAACACATGGTACGCCGAGTGCTACGCTGCCGCGAGGAAGATCCCCACC
CGCCACCCTCTCTCCCTTGACTTCTATGCAAAGACATGCCCGCAGCTCGACCAATTCGTCGCCTCCGTAACCGGCCAGCAGTTCCAGACCTCTCCCGCTTCCGGCCCCGCCACCATCCGC
CTTTTCTTCCATGACTGCTTCGTCGGG
GTAAGCAAGACGACCTTCCTAGAGCTTCTCGGCGGCCATTAATTCAGTCGCCGTTTGGGAACATGCAGGGTTGTGATGCGTCGATACTCATAG
CGCCAGGTCCTCGAGGTTCTCCGCCGGTGGAGAGGGACATGCCAGAAAACAGGAACCTGGCGCCAGAGGGCTTCGAGACGATCAACAAGGCCAAGGCGCTGGTGGAGAGCAAGTGCCCGG
GCGTGGTCTCCTGCGCCGATATCCTCGCCATTGCAGCGAGGGATTTCGTTCATCTG
GTATGCTCTCACTTAATATGATGAAGAAAAGCTTAAAAGTTCCCGTACGTTACACATCTAATTA
CCCATTTGCGCCATTTTTTCGCCGAAAGTCCCCAAATAGTACACTAATCTGCCTATTCAACCGTTATTTTCGTGCAAAAAGACCATACGTGTTATATCGGTACCACGTATGGCCGTCACT
TTCTCTCCTCAAAAGTCCCACCATAAATAATACACCAATTTCACGTACATAGTTGCGTAACCAATAAAAATTAGACAGATATCTCTGGATCGTCTTGTAGAATTTCGATCCGTCTCTGGT
CTCTCTCGTCTTGCTCTCCAACTCTCAACTCTCCCAAGAAGCTTCCTCAATGTCACCTTTCTCACCCACCCTCGCTCGCTAGGTTAATCTCTCATCACCATGATCAGGCCGCATGAAAGG
TCGAGAAATCTTATCTTTCCTTGTCCTTTCTTTGAAATAATGGTGGGGCAGCGCCAAAGCCGGCAGCATCCCTGACAGACCTGCCGTCTTTCGTTGCCTTGTGTATTTACTGTTGGTCTG
CACGACCTTGCTGATCCTTGTCGGGAATCCAAACCACGTCATTTGAATACGGAGGAAAAGGGCCTCGTTTTGTAGGACTATGTTTTCTCTGTTGACTTCACATGGGTCTTTAGTTTGTCT
AGCGTCTGGACATGGTAGTCACGGTGGATCCCTGCAGGTAGCAACTAGGCGGGGGGGTAGACTAGTCCTCCATTAGAAGGCTCCATTTCTATGTAACGTTAGTTAAAATAGTTTTCAAAT
AAATTAATTGTGAACTATGGTAAAATACGGCAAGACAAGTTGGTTCAATGAACATGCGTCGGTTTATACATAAAAGTCAAAGCTTTTTTAAAGAATATCATCGAATGGTGTAATAGCTGA
AATAATATCTCGTGAAGTTGGCTGGAAGTATTTAATTGTAACGAGTATGTGAAAACATGTCTCCGAATTGTTGATGAGGAGGCCCCGATTTGCACGTGAATGGATTGTTTTGTCGGCACA
TTGTGAATGCAGGCGGGGGGGCCCTACTATGCCGTGAAGAAGGGAAGAAGGGACAGCAGAGTCTCCCAAGCCGCCTGGGTGAAGTTCAACCTACCCCGCTCCAACTCCACCATGGACGAA
CTCATCAGTCTCTTCGCGAAGAAGGGGCTGAGCCAGGAGGACCTGGTGGCGCTTTCCGGCGCCCACACCATCGGTTTCTCCCATTGCCACCATTTCCTTGGCCGGCTCTACGACTTTCAG
GGCACCAGGCGGCCCGACCCGGTCATCAATCCGAGGCTCCTCAAAGCCCTCCAGATGTCCTGCCCTCCCTACGGCGGCAACACTGACGTCGTCGCACCGTTCGACGTGCAGACGCCGTTC
TCCTTCGACCACGCGTACTATGGCAACTTGCAGTCCCAGATGGGATTGCTGTTGACGGACCAGGCGCTGTTCCTGGACCCGCGAACAAGACCCGTCGTGCAGGCCTTGGCCAAGGACAAG
GCCAAGTTCTTCGCGTCCTTTGCGGCGGGGATGGACAAGATGGGCGCGTTCGGGGTGAAGAAGGGGAGAAAGGGGGAGCATAGAACGGATTGTACGAGGCACTCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTTATCCTGCTTCCGCCTCCGCCCTCAGCCTCGGCGCCGCCGTTTTAATCCTCTTCCTCCTGAGCAACACATGGTACGCCGAGTGCTACGCTGCCGCGAGGAAGATCCCCACC
CGCCACCCTCTCTCCCTTGACTTCTATGCAAAGACATGCCCGCAGCTCGACCAATTCGTCGCCTCCGTAACCGGCCAGCAGTTCCAGACCTCTCCCGCTTCCGGCCCCGCCACCATCCGC
CTTTTCTTCCATGACTGCTTCGTCGGG
GGTTGTGATGCGTCGATACTCATAGCGCCAGGTCCTCGAGGTTCTCCGCCGGTGGAGAGGGACATGCCAGAAAACAGGAACCTGGCGCCAGAG
GGCTTCGAGACGATCAACAAGGCCAAGGCGCTGGTGGAGAGCAAGTGCCCGGGCGTGGTCTCCTGCGCCGATATCCTCGCCATTGCAGCGAGGGATTTCGTTCATCTG
GCGGGGGGGCCC
TACTATGCCGTGAAGAAGGGAAGAAGGGACAGCAGAGTCTCCCAAGCCGCCTGGGTGAAGTTCAACCTACCCCGCTCCAACTCCACCATGGACGAACTCATCAGTCTCTTCGCGAAGAAG
GGGCTGAGCCAGGAGGACCTGGTGGCGCTTTCCGGCGCCCACACCATCGGTTTCTCCCATTGCCACCATTTCCTTGGCCGGCTCTACGACTTTCAGGGCACCAGGCGGCCCGACCCGGTC
ATCAATCCGAGGCTCCTCAAAGCCCTCCAGATGTCCTGCCCTCCCTACGGCGGCAACACTGACGTCGTCGCACCGTTCGACGTGCAGACGCCGTTCTCCTTCGACCACGCGTACTATGGC
AACTTGCAGTCCCAGATGGGATTGCTGTTGACGGACCAGGCGCTGTTCCTGGACCCGCGAACAAGACCCGTCGTGCAGGCCTTGGCCAAGGACAAGGCCAAGTTCTTCGCGTCCTTTGCG
GCGGGGATGGACAAGATGGGCGCGTTCGGGGTGAAGAAGGGGAGAAAGGGGGAGCATAGAACGGATTGTACGAGGCACTCTTAG

Retrieve as FASTA