Entry information : SpolPrx08 (Spipo12G0050200)
Entry ID 13206
Creation 2015-06-04 (Christophe Dunand)
Last sequence changes 2015-06-04 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-26 (Catherine Mathe)
Peroxidase information: SpolPrx08 (Spipo12G0050200)
Name (synonym) SpolPrx08 (Spipo12G0050200)
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolPrx08
start..stop
S start..stop
PtPrx52 415 9e-147 4..324 10..331
RcPrx44 407 1e-143 1..326 1..326
CsaPrx76 407 1e-143 29..326 29..326
EguPrx73 405 1e-142 7..326 11..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3594885..3595106 222 N° 2 3595198..3595377 180 N° 3 3595522..3595687 166 N° 4 3595764..3596179 416
join(3594885..3595106,3595198..3595377,3595522..3595687,3595764..3596179)


exon

Literature and cross-references SpolPrx08 (Spipo12G0050200)
DNA ref. Phytozome 12:   pseudo12 (3594885..3596179)
Cluster/Prediction ref. Phytozome Gene 12:   31503206
Protein sequence: SpolPrx08 (Spipo12G0050200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (302)
PWM (Da):   %s   34972.68 (32073.1)  
PI (pH):   %s   5.04 (4.91) Peptide Signal:   %s   cut: 26 range:26-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNLSRPLLILFVSLASVLLWPSCCSSPDLSPYFYAASCPDVELLVKGTVQSAAALDPTLPGKLLRLLFHDCMVEGCDGSVLLQGNGTERSAPESKSLGGFQVVDAAKRLLEIFCPGTVSCADILVLAARDAVELTGGPSVAVPLGRRDGRVSSASSVLPNIIDTTFTLDEMLNHFSSKGLSLEDLVALSGAHTIGLAHCSAFSERFDEAPNGTWIPADASLERGYAAELARRCSGRADETVTVGIEPGTASVFDNQYYRNVLVGKGLLGSDAQLAADSRTRRMVQDFSGNQEDFFRSWARSFLRLASVGVKTGREGEIRMSCPLRNR*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGTGATGCC CTGTGTGAGA AAAGGCTTTG GGACATGAAA TACAGGGGAG ATCAAAATTT TTATATGTGC GAGATTAGGA AAGACTTCAC AATTGATGCA ACTTTTAAAG GAAATTCTTC  TCGATTTTTG AACCACAGCT GTGATCCCAA TTGTAAGCTG GAAAAATGGT ATGGCATCCT GAACTTCTGT GGTCGACACT TTTCAGCAGA CAGATTATGA AAAATCTTGC TTTTTTCTGC  AACCTAAATC TCATAGATGC GTCGTTTTGA CAGTCGTATT TTTCTTCATT AGGCATGTTG ATGGAGAGAC CCGTGTTGGT GTCTTTGCAT CTCGAGCCAT AGAACCTCGT GAGCCATTGA  CGTATGACTA CAGGTACTGG TTGGCTTTAC ACCGTTCCTT GGTTTTTTGG AAGCTTCTCT TTGCATTTGC AGAGATCTTA TTCTCATGCT TTTTTTCTGT TGATATTTTA AGCATCAATT  TATGCTAGGG TCTATTATTT ATGTGGAGCT TGATTTTTCT AGAGTAGAAA AGATTTGTGG ATGGAGCTGA GATGTGATGC CTGTTCTCCA CAGGGATTAT CTTCTCTTAC ACACCTGTAA  AAGTTATTGA AAAATATGGA ATGTAAAACC CCTGCCAGAA AAGTAGAACA GAAAAATGGT TGAATGGGCT CAATGATATT ATCATTGGTT ATAGTAATAA TACGTCTTGA TCTCAGAATT  TGTGCAACTT TATTCCAGAC AAAGCCCATA AATCCTTCCC TCTCCCTACG CATTAATCTA ATACTCTTGC TTCATCATGT TTGAAAATGG AGCTTGCTGG ACAGGTCTCG CATAGTTTAA  GTCTTCAGAT TCAGTTCTCT CTTGTTGGAG CTTTTTTTTT AAAAAAAAAC TGTACTCTGC GACAATTAGA TAACTGTGTC TGGGATCTCA TTAATCTTCG CTGATCTTGA TCGTTCATAG  GTGGACAAGT TGACCCGCCC TCTTATATGA TTGTTTTTCC TCCAGATTTG TGCATTTTGG GCCCATGGTC AAGTGCCACT GTGGGGCTCC CAACTGCCGC GGCTACCTCG GGAGCAAGAA  GAAGATCAAT GAGCTGATCC ACAAGCTGGA TCCCTGTTGG GGGTGCAAGA GGAAGAGGTC ATCATTGGCC GTCGTCCGCA AGTCAACCCG AGTTGCCACT TGACCGCCAT TCAAACCCCA  TTCATTTAAT GTCTATAAGG GGACGAAGGT GAGTGGTCTA ACTCTCTCTC TCTCTCTCTC TCTCTCTCAT GCATGAAGGC AGAAACCATT CATTGACAGC GAGTTCTTCA TTTGTTTGTA  CATCGCTTCC GTTCCCCCCC CCCCCCCCCC CCCGGCCGAG CATTTTCTTT GGGCCGGGGT CCTGTTGTAC CTGAAACTGT GATTTGATCG ACTGGCAAGC AAGAAATCTG AAATAAGTTG  CTTACTTGTT CTACACTGCG CGTCGTCCAT GGGAGCCACC CAGATGCTGT TCGTCTTTTT GCAATAATGT CGGTCCATTG ATCGCCGGAT GCTCGTCCTC GAGCTGCTCT GGTCTGTGCA  GCTAACGGCG CCGCTTGAGC CTACGGCCTG CCACGTCGCC GGATGAGGGT TACGGATTAG GGTTTCTCCT CGTAGGCATT GAAAAGTTTG ACCAGTGACT GGAAGGGCGA TGAGGGTCCC  GAGGGCCTTC TTCTCTCGAC CTGTCGCCAT CTGAAGCTCT CTCGTCTGCG GAATAAGAGA ACTGTGGGGC TGAGCTGTCG AAACGGAGTG GAGAGCCCCC ATCTGGGTGA TTCCGCGGTT  TCACTCGTCT CATTAATGTC ACCGTCAGAG CCAGCATGAG GCCCAATTCA TTGCCGCCAT TAAAGAGGCT GGTGAGCTCT CCCAGTCCCC ACTTCCCTAC CGCGCTCGTC TTCCTTCAAA  TTCTTGCGGC CTTGTGGTCT TGCTGGCGAT GCACATTTAA ACTCAGCAGG CCTGCAGCAG AGCAGGAACC TGCGGGAGAG ATGAACCTAA GCCGGCCACT TCTTATACTC TTCGTCTCTC  TCGCTTCTGT GCTCCTCTGG CCTTCTTGTT GCTCTTCTCC AGATCTTTCC CCGTATTTCT ACGCTGCGTC ATGCCCGGAT GTGGAGCTTC TGGTCAAGGG CACGGTGCAG TCTGCCGCTG  CGCTGGACCC GACTCTGCCC GGCAAGCTCC TGAGGCTTCT CTTCCACGAC TGCATGGTGG AGGTAAGAAT TGGAAGCGCC GCAGGTTCTC GGAGGTCGCA GGGTGATGGG GCTCGGAAGA  TGTCTTTAAT GGCCGTTGGG TCCGGTCGCG CAGGGCTGCG ATGGGTCGGT GCTGCTGCAG GGGAACGGGA CGGAGAGAAG CGCACCGGAG AGCAAGTCGC TGGGAGGGTT TCAGGTGGTG  GACGCGGCCA AGCGGCTGCT GGAGATCTTC TGCCCCGGCA CCGTCTCCTG CGCTGATATC CTGGTGCTCG CCGCCAGAGA CGCCGTAGAG CTGGTGAGTC CACTCGCTGG GCAGCTTCCG  GCGGTGGGTT TCCGCTCTTG TGCCACGAAT CCGTGAGGCG GAAGGAGCGT GAGGTGGGTT TCGCCATTGA TGCATGGATC GAGGTTTTAC AGCTCCGAGT GTTGTGGTCT GTGGCAGACT  GGAGGGCCTT CCGTCGCCGT CCCCTTGGGC CGGAGGGACG GCCGGGTCTC GTCGGCGTCG AGCGTCCTGC CCAACATCAT CGACACCACC TTCACCCTCG ACGAGATGCT CAACCATTTC  TCCTCCAAGG GTCTCTCCCT CGAAGACCTC GTCGCCCTCT CAGGTACTGG TAATCCCCGG TCATCTTCAA GCTCTGTCCT CCTCCTCGGG GAACTGATTT TCTTCTCCAA TGCCGCCAGG  AGCTCACACT ATCGGGCTGG CCCACTGTAG CGCGTTCAGC GAGAGGTTCG ACGAGGCCCC CAACGGGACG TGGATCCCCG CCGACGCCTC CCTGGAGCGC GGCTACGCGG CGGAGCTGGC  GCGGCGGTGC TCCGGCCGCG CCGACGAGAC CGTCACCGTC GGCATCGAGC CGGGGACCGC CTCCGTGTTC GACAACCAGT ACTACCGCAA CGTGCTGGTG GGGAAGGGCC TGCTCGGCTC  CGACGCGCAG CTCGCCGCCG ATTCCCGCAC GAGGAGGATG GTGCAGGACT TCTCCGGCAA CCAGGAGGAC TTCTTCCGCA GCTGGGCGAG GTCGTTCCTG CGGCTGGCGA GCGTCGGCGT 
CAAGACCGGC CGCGAGGGAG AAATCCGCAT GTCTTGTCCC CTGCGGAACC GCTGA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACCTAAGCCGGCCACTTCTTATACTCTTCGTCTCTCTCGCTTCTGTGCTCCTCTGGCCTTCTTGTTGCTCTTCTCCAGATCTTTCCCCGTATTTCTACGCTGCGTCATGCCCGGAT
GTGGAGCTTCTGGTCAAGGGCACGGTGCAGTCTGCCGCTGCGCTGGACCCGACTCTGCCCGGCAAGCTCCTGAGGCTTCTCTTCCACGACTGCATGGTGGAG
GTAAGAATTGGAAGCGCC
GCAGGTTCTCGGAGGTCGCAGGGTGATGGGGCTCGGAAGATGTCTTTAATGGCCGTTGGGTCCGGTCGCGCAGGGCTGCGATGGGTCGGTGCTGCTGCAGGGGAACGGGACGGAGAGAAG
CGCACCGGAGAGCAAGTCGCTGGGAGGGTTTCAGGTGGTGGACGCGGCCAAGCGGCTGCTGGAGATCTTCTGCCCCGGCACCGTCTCCTGCGCTGATATCCTGGTGCTCGCCGCCAGAGA
CGCCGTAGAGCTG
GTGAGTCCACTCGCTGGGCAGCTTCCGGCGGTGGGTTTCCGCTCTTGTGCCACGAATCCGTGAGGCGGAAGGAGCGTGAGGTGGGTTTCGCCATTGATGCATGGATC
GAGGTTTTACAGCTCCGAGTGTTGTGGTCTGTGGCAGACTGGAGGGCCTTCCGTCGCCGTCCCCTTGGGCCGGAGGGACGGCCGGGTCTCGTCGGCGTCGAGCGTCCTGCCCAACATCAT
CGACACCACCTTCACCCTCGACGAGATGCTCAACCATTTCTCCTCCAAGGGTCTCTCCCTCGAAGACCTCGTCGCCCTCTCAG
GTACTGGTAATCCCCGGTCATCTTCAAGCTCTGTCCT
CCTCCTCGGGGAACTGATTTTCTTCTCCAATGCCGCCAGGAGCTCACACTATCGGGCTGGCCCACTGTAGCGCGTTCAGCGAGAGGTTCGACGAGGCCCCCAACGGGACGTGGATCCCCG
CCGACGCCTCCCTGGAGCGCGGCTACGCGGCGGAGCTGGCGCGGCGGTGCTCCGGCCGCGCCGACGAGACCGTCACCGTCGGCATCGAGCCGGGGACCGCCTCCGTGTTCGACAACCAGT
ACTACCGCAACGTGCTGGTGGGGAAGGGCCTGCTCGGCTCCGACGCGCAGCTCGCCGCCGATTCCCGCACGAGGAGGATGGTGCAGGACTTCTCCGGCAACCAGGAGGACTTCTTCCGCA
GCTGGGCGAGGTCGTTCCTGCGGCTGGCGAGCGTCGGCGTCAAGACCGGCCGCGAGGGAGAAATCCGCATGTCTTGTCCCCTGCGGAACCGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACCTAAGCCGGCCACTTCTTATACTCTTCGTCTCTCTCGCTTCTGTGCTCCTCTGGCCTTCTTGTTGCTCTTCTCCAGATCTTTCCCCGTATTTCTACGCTGCGTCATGCCCGGAT
GTGGAGCTTCTGGTCAAGGGCACGGTGCAGTCTGCCGCTGCGCTGGACCCGACTCTGCCCGGCAAGCTCCTGAGGCTTCTCTTCCACGACTGCATGGTGGAG
GGCTGCGATGGGTCGGTG
CTGCTGCAGGGGAACGGGACGGAGAGAAGCGCACCGGAGAGCAAGTCGCTGGGAGGGTTTCAGGTGGTGGACGCGGCCAAGCGGCTGCTGGAGATCTTCTGCCCCGGCACCGTCTCCTGC
GCTGATATCCTGGTGCTCGCCGCCAGAGACGCCGTAGAGCTG
ACTGGAGGGCCTTCCGTCGCCGTCCCCTTGGGCCGGAGGGACGGCCGGGTCTCGTCGGCGTCGAGCGTCCTGCCCAAC
ATCATCGACACCACCTTCACCCTCGACGAGATGCTCAACCATTTCTCCTCCAAGGGTCTCTCCCTCGAAGACCTCGTCGCCCTCTCAG
GAGCTCACACTATCGGGCTGGCCCACTGTAGC
GCGTTCAGCGAGAGGTTCGACGAGGCCCCCAACGGGACGTGGATCCCCGCCGACGCCTCCCTGGAGCGCGGCTACGCGGCGGAGCTGGCGCGGCGGTGCTCCGGCCGCGCCGACGAGACC
GTCACCGTCGGCATCGAGCCGGGGACCGCCTCCGTGTTCGACAACCAGTACTACCGCAACGTGCTGGTGGGGAAGGGCCTGCTCGGCTCCGACGCGCAGCTCGCCGCCGATTCCCGCACG
AGGAGGATGGTGCAGGACTTCTCCGGCAACCAGGAGGACTTCTTCCGCAGCTGGGCGAGGTCGTTCCTGCGGCTGGCGAGCGTCGGCGTCAAGACCGGCCGCGAGGGAGAAATCCGCATG
TCTTGTCCCCTGCGGAACCGCTGA

Retrieve as FASTA