Entry information : SpolAPx04 (Spipo9G0044500)
Entry ID 13220
Creation 2015-06-09 (Christophe Dunand)
Last sequence changes 2015-06-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-06-17 (Christophe Dunand)
Peroxidase information: SpolAPx04 (Spipo9G0044500)
Name (synonym) SpolAPx04 (Spipo9G0044500)
Class Ascorbate peroxidase    [Orthogroup: APx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolAPx04
start..stop
S start..stop
SpolAPx02 543 0 41..355 53..365
MtAPx07-A 521 0 47..356 61..368
MtAPx07-B 521 0 47..356 61..368
VuAPx03-2 520 0 54..355 41..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2885476..2885658 183 N° 2 2885215..2885358 144 N° 3 2884176..2884296 121 N° 4 2884001..2884101 101
N° 5 2883786..2883873 88 N° 6 2883019..2883086 68 N° 7 2882846..2882932 87 N° 8 2881969..2882043 75
N° 9 2881814..2881891 78 N° 10 2881615..2881719 105 N° 11 2881501..2881542 42  
complement(join(2881501..2881542,2881615..2881719,2881814..2881891,2881969..2882 043,2882846..2882932,2883019..2883086,2883786..2883873,2884001..2884101,2884176. .2884296,2885215..2885358,2885476..2885658))


exon

Literature and cross-references SpolAPx04 (Spipo9G0044500)
Protein sequence: SpolAPx04 (Spipo9G0044500)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364
PWM (Da):   %s   39588.93  
PI (pH):   %s   8.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACLRASLAAPAAAASRAAVTPYTTPFPSSAWSTLGSNSPSASRISLRFFAVSPLRSHMFLNLQAGRRSVRAFSGKPSATSFASDPSQLKSARKDIEELLRTTFCHPIMIRLGWHDAGTYDKNINEWPKRGGANGSLRFEVELKHAANAGLVNALARLQPIKDRYPGITYADLFQLASATAVAAGGPKIPMKYGRRDVTEPNQCPEEGRLPDAGPPSPAAHLRAVFYRMGLDDEIVALSGAHTLGRARPDRSGWGKAETKYTKDGPGTPGGHSWTVQWLKFDNSYFKDIKERRDEDLLVLPTDAALFEDPSFKVYAEKYAEDQDAFFKDYAEAHAKLSDLGAEFDPPQGFSIDGVSDSTEV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns). Incorrect prediction from Phytozome (two first exons are missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCCTTCGAGCTTCCCTCGCTGCCCCCGCCGCCGCCGCATCGAGGGCGGCGGTGACGCCTTACACAACGCCTTTCCCTTCTTCCGCCTGGTCCACTCTCGGGTCTAACTCCCCC
TCCGCCTCCCGCATCTCCCTGAGGTTCTTCGCCGTCTCCCCTCTCCGCTCTCACATGTTCCTG
GTAAAATAACTTGCTACTTGCTGTGGATTAAATGCGAACCTCTTTGACGTTGAGAAT
GGCGAAATTTTAATGGCATTGCTCACCGGTGTGTCTTCACGTGCTCTTTTCCGGTGGCAGAATCTACAGGCCGGAAGGAGGTCGGTGCGCGCATTTTCCGGAAAACCTTCTGCAACGTCC
TTCGCTTCTGATCCTAGCCAGTTGAAGAGCGCGAGAAAAGATATCGAGGAGCTGCTTCGAACTACGTTCTGCCATCCGATCATG
GTTGAGGATATAGCAAGCTACTGTTCTTCGAACGTT
CTTCCGCTAATTTCGCTCCCTTGTTCGACCGTTTCGTGGTTGACACAAGAATAGATTGCATTTCGTTGATGCCTAGTGCATAACTTCTCTTGGATTTAGAAGCTAGAGGCTCTTGGTCCT
TTTCCCCCATGTCGTGATTTCATTTGTATCGATGATTCTTCTGGTTGCAAACTGCGTTTTATTGGCTGTTCAATCTGGTAGACTGCTAACCTTAATGCCACTCTGGTACTGTCACTTATC
GTTGATTGACGATAAAGTGCAGGACGTTTTAGTGCTCGCCGTGTGAATTATTTAGTCTTAAGTTCTGAAGAAGTCAAACTGTGTTTGTATCGGTGCCGTGGATATTTTTTTATTGATTAT
TTAATATAAGGGGCAAGTAAATATTCAAAAGGGTTTATGTGAAACAAGGGAGGAATGAATCGTTTAGAAAATACAAATATTGTAATAACCATAAACCCTAAAGTTTCCTTTAGTGAGCGT
GAATGAGCCCAAAATTGATAACATTTGGCCCGGCTTCCGTTTGGAAAATTGTAGGGACTTTCGAGGTCATGATAGTGGAGCCTTTCCAATTTTGGTGGAAGAAAAGAAATGACGAGTCTG
GTTAGATGAAAGTCAATCATTCTCTCCTTGTCATTGGAATGTTAAGATTAAGATGAAGCTCCACATGAGAGCCCCTTGTTGCAAACAGGAGAAATGGCAAAGGTTTGATGTTATGGCACC
ATTTGGATGCTTGGGCCACATAAGCCTAAATCACATTTATTTGTGTGAAATGTTCCCCTTGTGGACAACTATTGTTCCTAAATCTTGTCTTTTTGAGAGTAACTATCGCAATGTTTCCGG
TTGATTTTATCTGGTAACTCATTTTCTGGGTTCCTATTTTAGATTCGGTTGGGATGGCATGATGCTGGTACCTACGATAAGAATATCAACGAATGGCCTAAAAGAGGTGGCGCAAATGGA
AGCCTGAGATTTGAAGTAGAGCTGAAACATGCAGCTAATGCCG
GTTTGTGATTGTTCTGGACCATCTCATTCAAAGATTCTTGATTTATGTTGCTGTCCATTGACATGATTCTGCAGGCC
TTGTCAATGCCTTGGCGCGACTTCAGCCCATTAAGGACAGATACCCTGGTATTACATATGCTGATCTATTCCAGTTAGCTAGTGCTACAGCAGTGGAG
GTTTGCATTTATTTCTGTCTCT
GATATGGTTCATTAGTGCTAAGGAAGAGGGAATTCGAAATTTAAAGTTTAGTGTAAATTGATAGCAAATGGTCATTTCTTCTTCTTCTTCTTTTTCAACCATCAGGCTGCTGGAGGCCCG
AAAATTCCTATGAAGTATGGTCGTAGAGATGTCACTGAACCCAATCAATGCCCAGAAGAGGGCAGGCTTCCTG
GTATGGCAATATCAAGGAACTGATTTGCTATTCAAATTTCATTGAGG
ATTCAATGTACATTTCTATTGTGCCCTTGGGATTTCCACCTAAATCTGTAAAGCAAGAAAAGAGCCTGCAAAGTGTCACCCGTGCACCCCTTAGATATCATTTTATGTGCCACATATAAT
CATTTATTAGTTTTAGCTTTTCTAGTATCATGGGCATATTTCAGTCTTTATCCACTTACTCCATGTTCTCTTTAGCTACTTAAGGTGATGCGCACAAGTGCTACATCTTTTGGATGTTGT
ACGTTGCCATTTATTGCAGTACAATGCACTTAATTTCCCTCTTGATTAAATATTTATAATTTATGTTCATGTGGCCAGCAGTAAAAAGTATGCTTCTCTTAAAAAAGTGTCGGCTGTGTT
AGCATAATCCCTTGGTACGATTTTCTTTTAGGTGAAGTCAACAATAATTGTATGACACTTTATCCATTCTGGTGATGGAGTTTTTTCCTTCTGGACTTGCCATTTCTTTTCTCAATTTCC
TGCTTACATGGCCTCACAATGATCAATACTGTTCTCAGGGGATTAACCTCACATAGCATTGACCGGGTTACCTTTGATTTATTGGTGTCCTTTTATGGTTGCCATTCCTGCTCACATTAT
TCAGTTATTGATTTACACTACCAGAGGGCTTACACTTGTTTTAAATGCCTAGATGCCGGCCCACCCTCACCTGCTGCACATCTGCGGGCTGTTTTCTACAGAATGGGTCTTGATGATAAG
GTTTGCATTACAGGATGAGGTCTTGAGATCCACTTTCACGCACAGCAAGATTACATCGCTCATTTCTAATCATCGCATCTATGTAGGAAATTGTTGCATTATCAGGTGCTCATACATTGG
GAAGGGCCAGACCTGATCGCAGTGGTTGGGGCAAGGCGGAGACGAAGTATACG
GTATGGATACCCTGTCCATTACAAAAGCTGCTATGGCAGCATGCTGATTGTTTTCCTCCTGGGAGCT
ATAAACCTTCTCTTAGGGGCATGTGTGATGGAGATGAGCGCAAGAACAGTGCTCAAGTCATATACCAAAATCCCTACCTGTTCTCCCTATATTATAAATTTATTTTTCTTTTTTCATTAA
AAAATTGTAATAATCTGGTATTATGCTTGTGACTAACACCAGAAGTAAACCATGACATTCATTGGAAATATTCAACCAGAGGACCCTCGAAGTGAGATTTTCGTCTGAAGCTGATTCCCC
CCCCCCCCCCGCCGTTAATGCTAATAAAGCATTTGCATTCAGCTTCATGGGTCATCCATGCAGAGCAACTAGGAAGGGTTCCTCAAATGGAAATCATAGATTAAGTAGAAAGAAGTTGAA
GTGTTTATTTTATGTCATGCAACCTTTCACATTTTTTTCCAGTTGATTAAAGCCGTTGCATCTCCAATCCCATGCATTGCTTTACAAGCTTAGTTTTTCAAATATCTACTCTGATTGTGT
CGGACGGAATATTAACTATGCAAATATATATGTCATAGAATGAATGAGTGTCAATAATTAAGGCATGCCAAGGACATGCTCCTCTTCCCTCCCCTGAAAAAAAAGCAAAATGATATAGAG
GCCACCACTGCGTAGGATGGTTTGCTTATTGTTAGTCTAGAACATAATATCTTTCGATCTTGTTACATATGGTTTAATGAAGATGCTTTCTTTTTGTGGAGAAATTATCTCACCTGATCA
TCTTCTGCTTGACAGAAGGATGGCCCTGGGACCCCTGGTGGTCATTCATGGACTGTCCAGTGGTTGAAGTTCGATAACAGCTATTTTAAGGTAAGAAAAGAAAGCTACCCTTCTTTCTTC
TTTTATTCCCTGGTGCGTGAATCCAGACTGCCGGTTATTTTTTCCAGGATATCAAAGAACGAAGAGACGAAGATCTACTTGTTCTGCCCACTGACGCTGCCCTCTTTGAAGATCCCTCCT
TCAAG
GCAAAACGAAACTCTGAACAAAGTCAGACCATATTCGAGTTAGGCAAATGTGGGTCTAATCTGTTGTCTTCATTGAAATCCGGTGCTCCTTCAGGTGTATGCTGAGAAGTACGCT
GAGGACCAGGACGCCTTCTTCAAGGACTACGCAGAGGCCCATGCCAAACTCAGTGACCTTGGCGCCGAGTTCGACCCTCCTCAG
GTGCGTCTCTGAACCACCATCTCTCCTCCTTGGCAG
CAGATAATATATAGCTTATGATGACCGCCCAACCAGGGCTTCTCCATTGATGGCGTCTCCGACAGCACCGAGGTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCCTTCGAGCTTCCCTCGCTGCCCCCGCCGCCGCCGCATCGAGGGCGGCGGTGACGCCTTACACAACGCCTTTCCCTTCTTCCGCCTGGTCCACTCTCGGGTCTAACTCCCCC
TCCGCCTCCCGCATCTCCCTGAGGTTCTTCGCCGTCTCCCCTCTCCGCTCTCACATGTTCCTG
AATCTACAGGCCGGAAGGAGGTCGGTGCGCGCATTTTCCGGAAAACCTTCTGCAACG
TCCTTCGCTTCTGATCCTAGCCAGTTGAAGAGCGCGAGAAAAGATATCGAGGAGCTGCTTCGAACTACGTTCTGCCATCCGATCATG
ATTCGGTTGGGATGGCATGATGCTGGTACCTAC
GATAAGAATATCAACGAATGGCCTAAAAGAGGTGGCGCAAATGGAAGCCTGAGATTTGAAGTAGAGCTGAAACATGCAGCTAATGCCG
GCCTTGTCAATGCCTTGGCGCGACTTCAGCCC
ATTAAGGACAGATACCCTGGTATTACATATGCTGATCTATTCCAGTTAGCTAGTGCTACAGCAGTGGAG
GCTGCTGGAGGCCCGAAAATTCCTATGAAGTATGGTCGTAGAGATGTCACT
GAACCCAATCAATGCCCAGAAGAGGGCAGGCTTCCTG
ATGCCGGCCCACCCTCACCTGCTGCACATCTGCGGGCTGTTTTCTACAGAATGGGTCTTGATGATAAGGAAATTGTTGCATTA
TCAGGTGCTCATACATTGGGAAGGGCCAGACCTGATCGCAGTGGTTGGGGCAAGGCGGAGACGAAGTATACG
AAGGATGGCCCTGGGACCCCTGGTGGTCATTCATGGACTGTCCAGTGG
TTGAAGTTCGATAACAGCTATTTTAAG
GATATCAAAGAACGAAGAGACGAAGATCTACTTGTTCTGCCCACTGACGCTGCCCTCTTTGAAGATCCCTCCTTCAAGGTGTATGCTGAGAAG
TACGCTGAGGACCAGGACGCCTTCTTCAAGGACTACGCAGAGGCCCATGCCAAACTCAGTGACCTTGGCGCCGAGTTCGACCCTCCTCAG
GGCTTCTCCATTGATGGCGTCTCCGACAGC
ACCGAGGTCTGA

Retrieve as FASTA