Entry information : SpolPrx26 (Spipo4G0080500)
Entry ID 13228
Creation 2015-06-09 (Christophe Dunand)
Last sequence changes 2015-06-09 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-25 (Catherine Mathe)
Peroxidase information: SpolPrx26 (Spipo4G0080500)
Name (synonym) SpolPrx26 (Spipo4G0080500)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolPrx26
start..stop
S start..stop
BvPrx42 453 2e-162 5..314 1..310
AcoPrx39 447 8e-160 1..314 8..321
CroPrx09 440 8e-157 1..314 8..321
NtPrx07-1A 440 9e-157 17..314 30..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6522429..6522623 195 N° 2 6522716..6522904 189 N° 3 6522987..6523149 163 N° 4 6523225..6523622 398
join(6522429..6522623,6522716..6522904,6522987..6523149,6523225..6523622)


exon

Literature and cross-references SpolPrx26 (Spipo4G0080500)
DNA ref. Phytozome 12:   pseudo4 (6522429..6523622)
Cluster/Prediction ref. Phytozome Gene 12:   31503545
Protein sequence: SpolPrx26 (Spipo4G0080500)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (295)
PWM (Da):   %s   33951.33 (31878.1)  
PI (pH):   %s   7.99 (8.21) Peptide Signal:   %s   cut: 20 range:20-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLLLIGLAIAGPRLDVEALSMDYYAASCPFVEMIVRDAVNQALRRDPTLSGPLLRMHFHDCFVEGCDGSVLIDSTKGNKAEKDSPANLSLRGFEVIDQAKKAVEQHCPGVVSCADIVAMVARDAVLWAGGPLYDIPKGRLDGRRSRIEDTINLPAPTLNSSALIKIFGQRGFTVQEMVALSGGHTLGVARCSSFKNRLSNFNSISRVDPSLDQSFAKTLVKACAAGDSSEVSFDSTRTLFDNAYFRALPVGGGLLSSDQTLFTSPETRGLVSAYAMNPARFFLDFSQAMVKMGLLKVKDGARGEVRLDCRRVN*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTTTATCAC AATTGAAACA TGTCATTTTG ATGGAGTTAT TGTATTTTTC AATCTAGATG ACACTTTTAG CATGAATTAT TTAGCTTGGA GATGAACTAA TGTGTCTCAA ATGGGCTTGT  CTCACAAAAC CCCTAGACGA TAGTCCAAGC TTTTAAGAAA TTTAAAACAA TCATCACTCA AAGCCTGCTT GAATGAAAGG CATCCTTGAT TGATCTCTTC TTCAACTCAT CAAATCTCCA  AAAACTCATA ACATGGAGCT TTGAGTTGTA TTTAAAGATA TGATGGTACC CAGTGGGCAA TTGTATTCTA GATGGCTTGA GTGTATTACA TCAACATGAG AAACTTTTGG GATAGAGTGA  GTGACAAATA TTGAGGATAA CCTTATGACA TGTCATGCAC ACTTAATTTT CATCTTTTTT CAATCTAATA TTAAATAATA TAATAGTTTC TAAAGTCACT AAATTTCTTG TTGCATTAAC  CAATCTACAC CTGAAGAATG TTCTACCCAT AGCTAAGTTT ACAAAAAATA TTGATTTAAT TCAAAAAATT GCATGCCAAG ACACTCCACA GCTAAATGAA AAGGGTCAGT AAAGGCATCA  GATAAATAAA GATTTTTTAT TTACCATGAT TTATCATTTA GATGAAAATG TTATTTGATG TCTCATTACC TTGCCATATG CATTGTGGTC CTAAGTGAGC ATGGAGAACA ATGTTTTAAA  CAAGATGCTA CATTGGGCAA ATCTATTGCA ATGCATGTTG GATGGAGGTT CAATCTAATT GATGATATGA CTGTGTTGAA ATAATCTCCC CTATAGCTAA GCCATGCACC AAGACTCTAA  ATAACTACGT CGATGTGATA CCGACCAACT AGAGGTAAAA AATGACTCGG CCAATTAAAG GAATATACAA GTACATGCGC TCACACACAC TCTTCTCAAC CTCGTTTTTT TAACTTTAGA  AGATCCTTGT GCGGATTAGG CCAAGCTCCA CGGACCCTGT TTGATAGGAT GGCCAACCTT AGTTCTTTAG TACACACGAA CAGTGCGGGC CAAGTGTTCG ACAATCAGTT CAAGAGGCTG  GTAGAACCTG GATCTTTGAC CTGACAACAA TGATAAAGCT GCCCGCGAGA AAGTAGAGCT TTTAGGGGAG TGGAGGCAAC TCGGTGGGGG AGGGCTGGCC ACTTCGGGAT GTCGACAAGA  AGGAAGTCCA GTCACAGACA GGTGCCCCCG GGACGGCGAC CGAGACTGGG GAGCTTCTCT CCGTCTGTTC CAGTCCCATT CTCACTACTC CTGAGAAGAC GATAGAGAAG TAGGTGACGA  CTATGATGGG GGCAAGACGA GCTCTCCAGT AGCTCGGTGC AGCTGTCGTC CGCCACATCT CGTTGGTGAT GGCATCGGTT ATGGGAAATA TGATCGTATC ACGCGGATGC GAGGTGTTCT  TCCGAGGAGG CGCCACTATG GACGAAAGGC CGATGATGAT AGCAACGACT GGGAAGATAA AGAGAATCCG AATGTGGAGA CCAGCTGCAA CCTATCTCAG CGTCACGTTC AGCCCACGTG  ATTATTGAAG TTTATCAAAA TCATCATCGA ACTGGAAAGA GATTCGAATT GACCATGGTC AACCCACTCG TGCCCATCGT CATGTGTAAC AGAAGGTGCC TGCACTGGCG GCTTCCCCCG  CTGATGACGA TGAGTGAGGG ATGGGAAGAG CTTTTCGACC TATTTTTTAG TTAAAGCAGC TTCCAGTTTT GAGTGTCCTT GGTCACCAAT GGTCATTATC TGACTCTCAC AGGAGGGGAT  AAGGGGATCC AGAGCCAAAA GCAGTGGAGA TGACGGGTAT ATATAGCCAG CCTTCGTCCT CCCCTTCGAG CATCAGCTTT ACTCATCCCT TCCAATCGTC TGAAACCCCA GCCTCTGCAA  CATCTACACC GTTTCCCCTT TTCCTGATCT TCTGGAAGAT TTTTGGTAGG GTTCTGATGG GTAGTTCTCG TATGGCGGAG ATGCTGCTGC TGCTGATCGG GTTGGCGATT GCCGGGCCCA  GATTGGATGT GGAAGCTCTG TCGATGGATT ACTACGCAGC TTCCTGCCCT TTCGTGGAGA TGATAGTCAG AGACGCAGTA AATCAAGCTC TCCGGAGGGA TCCCACCCTT TCTGGGCCGC  TTTTGAGGAT GCACTTCCAC GACTGCTTCG TGGAGGTGGG TTCAGGGTCT AGACTTCATC ACCATCATCA TCATCGTCTT CATCCGCTAC CTCTTCTTCA TGGATCTTCC GGCTTTGACT  GGTGCAGGGC TGCGATGGCT CCGTTCTGAT CGATAGCACG AAGGGTAACA AGGCAGAGAA AGACTCTCCT GCGAATCTAA GCCTGCGGGG CTTCGAGGTC ATCGACCAGG CAAAGAAGGC  CGTAGAACAG CATTGCCCGG GAGTCGTCTC TTGCGCTGAC ATCGTCGCCA TGGTGGCGAG GGATGCTGTC CTCTGGGTAA ATGACCAGAC ATTCTAAATT CAGAGTCTGC ACCTGAAACG  TTGACTTTCA TGTTAAACCT GCCGTTGCCC TCTTCCAGGC CGGAGGTCCG CTCTACGACA TTCCCAAGGG CCGACTGGAC GGCCGGAGAT CCAGAATAGA AGACACCATC AACCTGCCAG  CCCCGACTCT CAACAGCTCG GCCCTCATCA AGATTTTCGG TCAACGCGGC TTCACTGTTC AGGAGATGGT CGCCCTGAGC GGTAACGATC GAATTGCGTC TTTTCTTCTT CCGGCTCGAC  ACGTCTGACA GCGATCGCCG GCGGCCGCCA TTTCAGGGGG GCACACTCTC GGTGTGGCGC GGTGCTCCTC GTTCAAGAAC CGGCTGAGCA ACTTCAACTC CATCAGCAGG GTTGACCCGT  CCCTCGACCA GAGCTTCGCC AAGACACTGG TCAAAGCTTG CGCCGCCGGC GACAGCTCCG AGGTGTCGTT TGACTCGACC AGGACCTTGT TCGACAACGC CTATTTCCGG GCCCTCCCTG  TCGGAGGCGG CCTCCTGAGC TCTGACCAGA CGCTGTTCAC AAGCCCGGAG ACGAGGGGCC TGGTGAGCGC CTACGCCATG AACCCGGCAA GGTTCTTCCT TGACTTCTCG CAGGCCATGG 
TGAAGATGGG CCTGCTCAAA GTCAAAGACG GCGCCCGCGG GGAGGTCCGC CTTGACTGCC GCAGGGTCAA CTGA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCTGCTGCTGATCGGGTTGGCGATTGCCGGGCCCAGATTGGATGTGGAAGCTCTGTCGATGGATTACTACGCAGCTTCCTGCCCTTTCGTGGAGATGATAGTCAGAGACGCAGTA
AATCAAGCTCTCCGGAGGGATCCCACCCTTTCTGGGCCGCTTTTGAGGATGCACTTCCACGACTGCTTCGTGGAG
GTGGGTTCAGGGTCTAGACTTCATCACCATCATCATCATCGTCTT
CATCCGCTACCTCTTCTTCATGGATCTTCCGGCTTTGACTGGTGCAGGGCTGCGATGGCTCCGTTCTGATCGATAGCACGAAGGGTAACAAGGCAGAGAAAGACTCTCCTGCGAATCTAA
GCCTGCGGGGCTTCGAGGTCATCGACCAGGCAAAGAAGGCCGTAGAACAGCATTGCCCGGGAGTCGTCTCTTGCGCTGACATCGTCGCCATGGTGGCGAGGGATGCTGTCCTCTGG
GTAA
ATGACCAGACATTCTAAATTCAGAGTCTGCACCTGAAACGTTGACTTTCATGTTAAACCTGCCGTTGCCCTCTTCCAGGCCGGAGGTCCGCTCTACGACATTCCCAAGGGCCGACTGGAC
GGCCGGAGATCCAGAATAGAAGACACCATCAACCTGCCAGCCCCGACTCTCAACAGCTCGGCCCTCATCAAGATTTTCGGTCAACGCGGCTTCACTGTTCAGGAGATGGTCGCCCTGAGC
G
GTAACGATCGAATTGCGTCTTTTCTTCTTCCGGCTCGACACGTCTGACAGCGATCGCCGGCGGCCGCCATTTCAGGGGGGCACACTCTCGGTGTGGCGCGGTGCTCCTCGTTCAAGAAC
CGGCTGAGCAACTTCAACTCCATCAGCAGGGTTGACCCGTCCCTCGACCAGAGCTTCGCCAAGACACTGGTCAAAGCTTGCGCCGCCGGCGACAGCTCCGAGGTGTCGTTTGACTCGACC
AGGACCTTGTTCGACAACGCCTATTTCCGGGCCCTCCCTGTCGGAGGCGGCCTCCTGAGCTCTGACCAGACGCTGTTCACAAGCCCGGAGACGAGGGGCCTGGTGAGCGCCTACGCCATG
AACCCGGCAAGGTTCTTCCTTGACTTCTCGCAGGCCATGGTGAAGATGGGCCTGCTCAAAGTCAAAGACGGCGCCCGCGGGGAGGTCCGCCTTGACTGCCGCAGGGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCTGCTGCTGATCGGGTTGGCGATTGCCGGGCCCAGATTGGATGTGGAAGCTCTGTCGATGGATTACTACGCAGCTTCCTGCCCTTTCGTGGAGATGATAGTCAGAGACGCAGTA
AATCAAGCTCTCCGGAGGGATCCCACCCTTTCTGGGCCGCTTTTGAGGATGCACTTCCACGACTGCTTCGTGGAG
GGCTGCGATGGCTCCGTTCTGATCGATAGCACGAAGGGTAACAAG
GCAGAGAAAGACTCTCCTGCGAATCTAAGCCTGCGGGGCTTCGAGGTCATCGACCAGGCAAAGAAGGCCGTAGAACAGCATTGCCCGGGAGTCGTCTCTTGCGCTGACATCGTCGCCATG
GTGGCGAGGGATGCTGTCCTCTGG
GCCGGAGGTCCGCTCTACGACATTCCCAAGGGCCGACTGGACGGCCGGAGATCCAGAATAGAAGACACCATCAACCTGCCAGCCCCGACTCTCAAC
AGCTCGGCCCTCATCAAGATTTTCGGTCAACGCGGCTTCACTGTTCAGGAGATGGTCGCCCTGAGCG
GGGGGCACACTCTCGGTGTGGCGCGGTGCTCCTCGTTCAAGAACCGGCTGAGC
AACTTCAACTCCATCAGCAGGGTTGACCCGTCCCTCGACCAGAGCTTCGCCAAGACACTGGTCAAAGCTTGCGCCGCCGGCGACAGCTCCGAGGTGTCGTTTGACTCGACCAGGACCTTG
TTCGACAACGCCTATTTCCGGGCCCTCCCTGTCGGAGGCGGCCTCCTGAGCTCTGACCAGACGCTGTTCACAAGCCCGGAGACGAGGGGCCTGGTGAGCGCCTACGCCATGAACCCGGCA
AGGTTCTTCCTTGACTTCTCGCAGGCCATGGTGAAGATGGGCCTGCTCAAAGTCAAAGACGGCGCCCGCGGGGAGGTCCGCCTTGACTGCCGCAGGGTCAACTGA

Retrieve as FASTA