Entry information : SpolPrx28 (Spipo8G0010000)
Entry ID 13230
Creation 2015-06-09 (Christophe Dunand)
Last sequence changes 2015-06-09 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-25 (Catherine Mathe)
Peroxidase information: SpolPrx28 (Spipo8G0010000)
Name (synonym) SpolPrx28 (Spipo8G0010000)
Class Class III peroxidase    [Orthogroup: Prx065]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolPrx28
start..stop
S start..stop
EgrPrx74 392 9e-138 22..326 12..317
EcamPrx74 392 2e-137 22..326 26..331
EglPrx74 391 2e-137 22..326 12..317
LuPrx100 380 5e-133 6..326 5..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 973888..974088 201 N° 2 973460..973808 349 N° 3 972953..973392 440  
complement(join(972953..973392,973460..973808,973888..974088))


exon

Literature and cross-references SpolPrx28 (Spipo8G0010000)
DNA ref. Phytozome 12:   pseudo8 (974088..972953)
Cluster/Prediction ref. Phytozome Gene 12:   31511238
Protein sequence: SpolPrx28 (Spipo8G0010000)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (308)
PWM (Da):   %s   35217.94 (33091.7) Transmb domain:   %s   i5-27o
PI (pH):   %s   5.19 (5.03) Peptide Signal:   %s   cut: 22 range:22-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGRFLLGLLSLFVALGGAAPLEVLFYKETCPRAELISRDVVEKHLRRDPTIAAGIIRMFFHDCFVRGCDGSVLLDSTGDTVAEKEAPPNLTLRGFEAIDEIKTTLERECRGTVSCADVLAMAARDSVALSGGAAYELPTGRRDGLVSDATAVHLPGPSSSIFEAIKAFEGINLTVVDLVTLLGAHSVGLCHCGFFVDRLYSFRNTGMPDPSLDASLLAALRQRCPDSAATAENISAEPTVFMNQATSSPFTLDSSFYRGVLHNRAVLQLDQELAYADLSNSLAATFLTTPKLFISSFSKSMIRLGNVGVLTGDQGEIRLNCRQVNGVA*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTCTTCGTT TATTTACTTT TCTGTTTTTA GAAAATAAAA AATCACAGCA GTCCAAGTGA CGGTTCAGAA TGGCTTGCCA CCTAGGCTCA TGGACTTCCT CTCCTCCCCC CCCCCCCCCC  CCCCAACGAG CAATAAACCA CAGCCACATT ACAAACCCAT TGTCGCTTGA ATAGTAATTT TTTTTAAAAA ATGATTAATT TTTTAAAAAA ATAGTTAAAT GTTTTACCTG TTAATCAATT  TCACATTGAA TTTTTACCCA TATTTTTTTG CTCAGATATC AATTAATATA GTTTAAAGAA AACCGTGCTT CGTCCAAGCA CACGCTAGGG GTGTGAAATG TCCAAAGTTG TGGCCTTTTA  CAAAGTTCTA TTGGTTTTCT GTGGTTAAGA AGCGAAGAAA GGTCAACGTA GCAAACCACC CTGGATGCCA TGCGATCAGC TCGTCAAGTG GTGAGATGTC TCCGGAGGTT CGCTAAATGC  GAAAGTGGGG TGCCAATGGA TGACACTTGT CTCAGAAGAA GTAGATGGGG CACCGCCGGC CCTCGGCCGC CGGCAGGATC GAGCCGTCGG GGCCGACGCC GGCTTCGCAG TCAACGTTCA  TATCGTGGTG GTGAGTATCC CAAGTCTTCA CCCTGAACCG GATGGCAGCC TCCAGCCGCA GCCTGAACCA GACCTCCCCT GTGGCCGCCA AGTCAGCCCT GATCTGGCTC AACAGAGACT  GATCAACGGC CAGCCCCTGC TCCGACATCT CCCCCCGGAT TTCCGTCGTG TTCTTCGGCG GCTGGTAGAA CGGGGGCAGC AGCTCTCTGG CGGCGCCGAC GCCGTCGTCA CGGTAGAACA  GCTCGCCGCG CATAGCGTTG TCGTAGAAAA TGCCGATCTT CTGATTAGGG TTTCGGAGCA GCACGTGGAA GGAGAAGACG GCGGCGGTGC GGTTGTCGGA GAGGCCGGCG GCGGAGAAGC  CGGCGAGGTG GAAGCGGGGA CGGTGGGGGC GGAGGCTGAG CCAGAGGATG AAGACGAGGA TGGCGACGAT GAGGGAGAGG GTGAGGAAGA TGGAGCAGAA GACGCGGCAG ACCCTGCTCG  TCAACGTGTC CTGCATTCGC TTCGCCACGT ACTGGGTCCT GTCCAGCCGG TGCTCGAACG GCGGCGGCGG CGGCTCCATG GTGGGCACGG GCGGTGCAGG AGGCTCCATG GTTGGGTTTA  AGAGCTGAGG AGATGGCGGA GGGAGAAAGC CATTCCACGG AGCTCTAAGC TCCAACGGGG AAAGGAATAA ATTCCTACGG CGGGGGGGAA TTAGGGCAGA AGATAACCTG TTATGGGGAG  ACGATACAGA GCTGTGCCGT CTGAAGTGAG GAAAAGAACA ATAAAGGAAT GATGTGCAGG CTAAGCCGGC GGAAGGGCTG CAGGAGGCAA GCTAGGGTTT TGCTTTGCCG TGCGAGAGAG  GGCAGAGAGA AGGCACAAGA AAGCTAGGGT TAACCACGTA GAAATATACC AACAGCCTTT CACTGGTGCT AGCATACACG TATAAGCGAG AGAGGGAGAG GGAGATGGAG TGGGAGAGAG  GGAGGCAGAG ATCCTTGCTT GGATCTGCGT CAGGGATAGT AATATACCGG ACATGCTTAT AAACTTTCAG TATAAATGAC GTATTTGGTC AACGTGTCAT TCTTTCGTAG GTCATCCCCG  ATCCAGGGCC AGCTGTGGCT TGGAAATTTT CTCCACGTGT AGTCTGGTCT ACTGCCACTA CAAGATGCCT TCAGCAACTT CCCGTTACCC CCACATGAAG AGTAAGAAGA TAGAATAAGA  TATATGATAG GGGTTATTAT AGTACGAAGG AGAGAGCTTC CCCATGCAGC CCCACGCCAC CTCGTCGTGA AACCCGCCGA CCTTCGCGAC GACGAGGGTG ACCCAGAGAA GAGACTAAGA  ACGAAACTCA ACAGATCTTC CGAAAAGAGC TTCTCTTCCC AAAATAAGAG CAGACTCTGA GACATCTCCG GCCTTCGCAA ATGGCGGGTC GCTTCCTCCT CGGCCTTCTC TCTCTATTTG  TGGCGCTGGG CGGGGCGGCC CCCCTGGAAG TCCTCTTCTA CAAGGAGACC TGCCCCAGGG CGGAGCTCAT CTCCCGGGAC GTGGTGGAGA AGCACCTTCG GAGGGACCCC ACCATCGCCG  CCGGCATCAT CCGCATGTTC TTCCACGATT GCTTCGTGAG GGTGAGAACT ACTTGTTATT TCTCCTTCTC CTGCTTCTTC TCTGGCGCCG CGAGATGCCT GACCGGGGAG AATGTTCCAG  GGGTGCGATG GCTCCGTTCT CCTCGACAGC ACCGGCGACA CCGTCGCGGA GAAGGAGGCC CCACCGAACC TAACCCTAAG GGGGTTCGAG GCCATCGATG AAATCAAGAC CACCCTGGAG  AGGGAGTGCA GGGGCACTGT CTCCTGCGCT GACGTCCTGG CCATGGCCGC CCGCGACAGT GTGGCCCTCT CCGGCGGCGC CGCCTACGAG CTACCCACCG GCAGACGGGA CGGCCTCGTC  TCGGACGCCA CGGCGGTCCA CTTGCCCGGG CCCTCCTCCT CCATTTTCGA AGCCATTAAA GCCTTCGAGG GGATCAATCT CACAGTCGTA GACCTCGTCA CGCTGCTAGG TAAATTAGAA  CAGACCTTCA TCTTCTACAA TGTTAGAAAG CCTGATTCCC TTTAAATTTC CAACAGGTGC TCACAGTGTA GGGCTCTGCC ACTGCGGCTT CTTCGTCGAC AGGCTTTACA GCTTCCGGAA  CACCGGCATG CCGGACCCGT CCTTGGACGC CAGCCTCCTC GCAGCCCTAC GGCAGCGGTG CCCCGACTCC GCCGCCACCG CGGAGAACAT ATCAGCGGAA CCGACCGTGT TCATGAACCA  AGCGACCTCC TCGCCCTTCA CCTTGGACAG CTCCTTCTAC CGCGGCGTCC TCCACAACAG GGCGGTGCTC CAGTTGGACC AGGAGCTCGC CTACGCTGAC CTCAGCAACA GCCTGGCGGC  GACGTTCCTG ACCACGCCTA AGCTCTTCAT CTCGAGTTTC TCTAAGTCGA TGATTAGGCT GGGGAACGTG GGAGTGCTCA CCGGTGACCA GGGGGAGATC AGGTTAAACT GTCGGCAAGT 
CAACGGCGTC GCGTAG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGGTCGCTTCCTCCTCGGCCTTCTCTCTCTATTTGTGGCGCTGGGCGGGGCGGCCCCCCTGGAAGTCCTCTTCTACAAGGAGACCTGCCCCAGGGCGGAGCTCATCTCCCGGGAC
GTGGTGGAGAAGCACCTTCGGAGGGACCCCACCATCGCCGCCGGCATCATCCGCATGTTCTTCCACGATTGCTTCGTGAGG
GTGAGAACTACTTGTTATTTCTCCTTCTCCTGCTTCTTC
TCTGGCGCCGCGAGATGCCTGACCGGGGAGAATGTTCCAGGGGTGCGATGGCTCCGTTCTCCTCGACAGCACCGGCGACACCGTCGCGGAGAAGGAGGCCCCACCGAACCTAACCCTAAG
GGGGTTCGAGGCCATCGATGAAATCAAGACCACCCTGGAGAGGGAGTGCAGGGGCACTGTCTCCTGCGCTGACGTCCTGGCCATGGCCGCCCGCGACAGTGTGGCCCTCTCCGGCGGCGC
CGCCTACGAGCTACCCACCGGCAGACGGGACGGCCTCGTCTCGGACGCCACGGCGGTCCACTTGCCCGGGCCCTCCTCCTCCATTTTCGAAGCCATTAAAGCCTTCGAGGGGATCAATCT
CACAGTCGTAGACCTCGTCACGCTGCTAG
GTAAATTAGAACAGACCTTCATCTTCTACAATGTTAGAAAGCCTGATTCCCTTTAAATTTCCAACAGGTGCTCACAGTGTAGGGCTCTGCC
ACTGCGGCTTCTTCGTCGACAGGCTTTACAGCTTCCGGAACACCGGCATGCCGGACCCGTCCTTGGACGCCAGCCTCCTCGCAGCCCTACGGCAGCGGTGCCCCGACTCCGCCGCCACCG
CGGAGAACATATCAGCGGAACCGACCGTGTTCATGAACCAAGCGACCTCCTCGCCCTTCACCTTGGACAGCTCCTTCTACCGCGGCGTCCTCCACAACAGGGCGGTGCTCCAGTTGGACC
AGGAGCTCGCCTACGCTGACCTCAGCAACAGCCTGGCGGCGACGTTCCTGACCACGCCTAAGCTCTTCATCTCGAGTTTCTCTAAGTCGATGATTAGGCTGGGGAACGTGGGAGTGCTCA
CCGGTGACCAGGGGGAGATCAGGTTAAACTGTCGGCAAGTCAACGGCGTCGCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGGTCGCTTCCTCCTCGGCCTTCTCTCTCTATTTGTGGCGCTGGGCGGGGCGGCCCCCCTGGAAGTCCTCTTCTACAAGGAGACCTGCCCCAGGGCGGAGCTCATCTCCCGGGAC
GTGGTGGAGAAGCACCTTCGGAGGGACCCCACCATCGCCGCCGGCATCATCCGCATGTTCTTCCACGATTGCTTCGTGAGG
GGGTGCGATGGCTCCGTTCTCCTCGACAGCACCGGCGAC
ACCGTCGCGGAGAAGGAGGCCCCACCGAACCTAACCCTAAGGGGGTTCGAGGCCATCGATGAAATCAAGACCACCCTGGAGAGGGAGTGCAGGGGCACTGTCTCCTGCGCTGACGTCCTG
GCCATGGCCGCCCGCGACAGTGTGGCCCTCTCCGGCGGCGCCGCCTACGAGCTACCCACCGGCAGACGGGACGGCCTCGTCTCGGACGCCACGGCGGTCCACTTGCCCGGGCCCTCCTCC
TCCATTTTCGAAGCCATTAAAGCCTTCGAGGGGATCAATCTCACAGTCGTAGACCTCGTCACGCTGCTAG
GTGCTCACAGTGTAGGGCTCTGCCACTGCGGCTTCTTCGTCGACAGGCTT
TACAGCTTCCGGAACACCGGCATGCCGGACCCGTCCTTGGACGCCAGCCTCCTCGCAGCCCTACGGCAGCGGTGCCCCGACTCCGCCGCCACCGCGGAGAACATATCAGCGGAACCGACC
GTGTTCATGAACCAAGCGACCTCCTCGCCCTTCACCTTGGACAGCTCCTTCTACCGCGGCGTCCTCCACAACAGGGCGGTGCTCCAGTTGGACCAGGAGCTCGCCTACGCTGACCTCAGC
AACAGCCTGGCGGCGACGTTCCTGACCACGCCTAAGCTCTTCATCTCGAGTTTCTCTAAGTCGATGATTAGGCTGGGGAACGTGGGAGTGCTCACCGGTGACCAGGGGGAGATCAGGTTA
AACTGTCGGCAAGTCAACGGCGTCGCGTAG

Retrieve as FASTA