Entry information : SpolPrx29 (Spipo1G0078600)
Entry ID 13231
Creation 2015-06-09 (Christophe Dunand)
Last sequence changes 2015-06-09 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-25 (Catherine Mathe)
Peroxidase information: SpolPrx29 (Spipo1G0078600)
Name (synonym) SpolPrx29 (Spipo1G0078600)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolPrx29
start..stop
S start..stop
SpolPrx32 615 0 2..328 4..330
SpolPrx[P]33 461 5e-165 1..322 1..320
EcamPrx43 432 1e-153 9..328 5..321
EgrPrx45 432 2e-153 9..328 5..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4863149..4863367 219 N° 2 4862842..4863033 192 N° 3 4862565..4862730 166 N° 4 4862037..4862446 410
complement(join(4862037..4862446,4862565..4862730,4862842..4863033,4863149..4863 367))


exon

Literature and cross-references SpolPrx29 (Spipo1G0078600)
DNA ref. Phytozome 12:   pseudo1 (4863367..4862037)
Cluster/Prediction ref. Phytozome Gene 12:   31520820
Protein sequence: SpolPrx29 (Spipo1G0078600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (302)
PWM (Da):   %s   35838.4 (33094.0)  
PI (pH):   %s   9.53 (9.76) Peptide Signal:   %s   cut: 27 range:27-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGPRISGEIVFLALVLGMCLSATAEATLRVGYYQNTCPQAEFIVKKVVKKATKKDKGLPADFIRMHFHDCFVRGCDGSILIDSTSNNTAEKDSPINNPSLEGFEIIDEAKAKLEKQCKGIVSCADILAFAARDSVKLSGGFWYEVPSGRRDGRISRSSETFGNLPPPTFNLSQLTQNFASKGLNKHDLVTLSGAHTIGKSHCTSINSRLHNFSSTATTDPSLDPAYAKKLKKKCPKASTDTSLTVPMDPPSPEVFDSSYYKNILVHKGLFQSDQALLSSSKTAHLVKQNAANEHLFKKRFAEAMVKMGNIEVLTGKKGEIRLNCRVIN*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCTTAAATGT TGCTGGAAGA AGAGAACATT TCTAACAACA GTTCATCACT GGCTTGTGTC CACGGTCTGA TGGTAGTGAG GTTTTCGGTC GGATCAACAG CATCATATAT CGACGGTGAC  GAGGATTTTC AACCTCGTTG ATTCACAGAG ACATTTATGG AAGGTGGAAT GGAGCTTTCA AATTTTCAGC TCTTATGTCC ACGTGCCAGG TAATCATCAT AGACATATCA AAAGCTACAG  AAAAACTGCT CAAAGATGTC GTCGCAAGAT AACGAAGCGG TTGAGGAATC AATTCGAGAT GAATCTCCTG TCGGTGAGAA TTTTGCGAAA TCTCCCCGGG GTCTGATTTC TCTATTAGAT  AGGAACAGCG ACTGACTCCA TGGTGCCAAT AATAGTTCCT CACCAACTCT TTTCTTCTAG TGACAACGAC ATAAATCAGA AGACCTTGGT GGCTGTTGAA GAACCGAAGT CGCCACCTCA  CCTGCACGAT AGAAGGAAAG AGGACCCACA CTCTCGCCCA CGTATCGAAC AACAAGAGGA AGGGAGTGGG TTACGGTCAT GTCGCACATG TACCATGCAT CACCACCACG ACTTTGTTTA  TTATTAATTA GTTGTTATTA GTTAGTTATC TGTCTATCTT CCTGACTTCC AGACCTATAA AAATATGCTT GTAATATGGA TTGGATAGTT GAAGTTGAAT TCTTTTTTTC TCTTCATTTG  GAGAAGCCGC GAGGGCTACC TACGCTCTGA AAAGAGCTGA TCGTCAGGGT CAACTTTCTA TTCATTACTC TTTTTTCCTA CCACCCACAC TATCATGGTG ACTTGCTGTG TGAAGCAAGA  TTCCACACTT CAGATTTAGG GTCATTGCCG ACGGAAGGCA TGTAAGTTCC CCACTGGTAT TCTCTTTCTT TACCTTTTCT CCGTTAGATA ACTGTTATCT TTAACATTGC TTAATTATCC  TGAACACTTG AGCCTGATAA TTCCTCATCT CGTTCTTCAA ATATCCTAAC CTATCAGTTT TCTCAAAGTA CCACATCCAG CTTTGTCTTT TGTGGGTTAA TAGGGGACCG CATCAAATCT  CCTCAAATTC GTTGCTGTAT GGAAATTTAA CAGGTTGCGC GTTATCTTCC CATTCTTCCG CATCATCTAG TCCCGTCAAA AGGGACCATC AGTACCATTC GAGATGACAT CTGCTCTTTG  TCCGGGTTAC ACTTCCCTCC AACCGGAGTT TTCTTTCAGT ATAAAAGTAT AAATGAATAT TCTTAAGAGG AGTTAGAAAC GGATTCAAAT TAAAACCATT GAAGATAGGG AAAGCGGAAA  CAATGCCAGA GAAATCAGAA GAAAATCCAT GATCCTCGTG CCACATCTTC TCTGCCATCA TAAAGCTGCC GTCACGTCGA AGTGTGATGG ACACGCGTCT TTTATCGGAG GAGCACATCA  TAGTAAATAG CGTTGATCCG CTCCCCAGGA TTCAGCTTTT CACGTACAAA AGAGACGCAT ACTCGTCAAT CCAGTAGACT AATAAAAGGG GAACCAAAGA ATAACAGACT CCTTGCTTCA  AGAAGTTCAA CCGTCATCCG ACTTGGGGAA CAAGCTGGGT TGTCTGATCC CCAGGAATCT TAGCGATGTC ATAAGACGAC CTCCTCTTGA CATCCAATTA ATTATCACGG AACTACTGTG  TTGCGGTTAT TGTCATCATC ATAGTCCGTT AGAATCAAAC TCTTCTGTTT CTGCCCACTT GTCGCTGGTC AACAACGAGT GCCGTCGCCG TCAGGACGAG CTGTCGAAGT CTATATTCAA  GGAAACCTCC CTCATTCAAC CTCAACCTAA TACGTCCTAG CGATAGGCTA GCACCCAACC TCCACGAACC AGCTCTGCCA CACCATAATC CACTTAAATG GATAATCAAT AATTTCGATT  AAAATACCAG AGGGCTATCG ATCCGATGGT TATAAGTCAC GCACCGGAAG GCATGCAAAG GTATCAGAGA TTGAGCGACC ATGGGGCCGA GAATAAGTGG GGAGATAGTG TTCTTGGCCC  TGGTGCTTGG CATGTGTCTC AGCGCTACGG CAGAAGCTAC GCTTCGTGTC GGGTATTACC AAAATACATG TCCCCAAGCT GAGTTCATCG TGAAGAAGGT TGTAAAGAAG GCGACGAAGA  AGGACAAGGG TCTGCCCGCT GATTTCATCA GGATGCACTT CCACGACTGT TTCGTGAGGG TGTGTTACGT AGCCAGTTAC GCCGATATTT ATGTCTCTCG TCGAAAAGAA AATTATGCTC  GATTACCGTA GCTCGTCAAC GGCGGTTTAT CTTCTTTCCT TCTGATGTTT TTAGGGTTGC GACGGATCAA TTCTTATCGA CTCCACCTCG AACAACACCG CCGAGAAGGA CTCACCCATC  AACAACCCAA GCCTGGAAGG GTTCGAGATC ATCGACGAGG CCAAGGCCAA GCTGGAGAAG CAGTGCAAGG GTATCGTGTC CTGCGCCGAC ATCCTCGCTT TTGCTGCCAG AGATAGTGTT  AAGCTGGTAG AATCAATACA CCAATGTTCT TGACTACATC GTATCATTTG TGAACATAAG ACTTGGTGTC CCTGTGGATG ACCATGACTG CTCGGCTGAC TTTGTTCGTG ACTGCAGAGC  GGGGGATTTT GGTATGAGGT CCCCTCGGGA AGGAGGGACG GGAGGATCTC CCGTAGCTCG GAGACATTCG GAAACTTACC GCCTCCGACT TTCAATTTAT CACAGCTCAC ACAGAACTTT  GCCAGCAAGG GTCTGAACAA GCACGACTTG GTCACCCTAT CTGGTATGAA GAATACAAAC GTTTAAAGGG ATCTTTCAGT CGAACTTGGA CACAACTGAA CCCATATGCT GTGGTTCCTA  CGATTTTATT TTCTCATGTG GAGCTATTCT TGTAATTTCA GGGGCGCACA CCATCGGCAA GTCTCATTGC ACCAGCATCA ACAGTCGGCT GCACAACTTC AGCTCGACAG CCACCACCGA  TCCGAGCTTA GATCCGGCTT ACGCGAAGAA ACTAAAGAAG AAGTGCCCCA AAGCGAGCAC CGACACGAGC CTGACAGTCC CAATGGACCC TCCCAGTCCT GAGGTCTTCG ACTCCAGCTA  CTACAAAAAT ATCCTTGTTC ACAAGGGCCT CTTCCAGTCA GACCAGGCGC TCCTGTCGAG TTCCAAGACT GCGCATCTGG TGAAGCAGAA CGCGGCCAAC GAGCACCTCT TCAAGAAGAG 
ATTTGCTGAG GCTATGGTGA AGATGGGCAA TATCGAAGTG CTCACTGGGA AAAAAGGAGA GATAAGATTG AACTGTAGGG TGATCAATTG A 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCCGAGAATAAGTGGGGAGATAGTGTTCTTGGCCCTGGTGCTTGGCATGTGTCTCAGCGCTACGGCAGAAGCTACGCTTCGTGTCGGGTATTACCAAAATACATGTCCCCAAGCT
GAGTTCATCGTGAAGAAGGTTGTAAAGAAGGCGACGAAGAAGGACAAGGGTCTGCCCGCTGATTTCATCAGGATGCACTTCCACGACTGTTTCGTGAGG
GTGTGTTACGTAGCCAGTTAC
GCCGATATTTATGTCTCTCGTCGAAAAGAAAATTATGCTCGATTACCGTAGCTCGTCAACGGCGGTTTATCTTCTTTCCTTCTGATGTTTTTAGGGTTGCGACGGATCAATTCTTATCGA
CTCCACCTCGAACAACACCGCCGAGAAGGACTCACCCATCAACAACCCAAGCCTGGAAGGGTTCGAGATCATCGACGAGGCCAAGGCCAAGCTGGAGAAGCAGTGCAAGGGTATCGTGTC
CTGCGCCGACATCCTCGCTTTTGCTGCCAGAGATAGTGTTAAGCTG
GTAGAATCAATACACCAATGTTCTTGACTACATCGTATCATTTGTGAACATAAGACTTGGTGTCCCTGTGGATG
ACCATGACTGCTCGGCTGACTTTGTTCGTGACTGCAGAGCGGGGGATTTTGGTATGAGGTCCCCTCGGGAAGGAGGGACGGGAGGATCTCCCGTAGCTCGGAGACATTCGGAAACTTACC
GCCTCCGACTTTCAATTTATCACAGCTCACACAGAACTTTGCCAGCAAGGGTCTGAACAAGCACGACTTGGTCACCCTATCTG
GTATGAAGAATACAAACGTTTAAAGGGATCTTTCAGT
CGAACTTGGACACAACTGAACCCATATGCTGTGGTTCCTACGATTTTATTTTCTCATGTGGAGCTATTCTTGTAATTTCAGGGGCGCACACCATCGGCAAGTCTCATTGCACCAGCATCA
ACAGTCGGCTGCACAACTTCAGCTCGACAGCCACCACCGATCCGAGCTTAGATCCGGCTTACGCGAAGAAACTAAAGAAGAAGTGCCCCAAAGCGAGCACCGACACGAGCCTGACAGTCC
CAATGGACCCTCCCAGTCCTGAGGTCTTCGACTCCAGCTACTACAAAAATATCCTTGTTCACAAGGGCCTCTTCCAGTCAGACCAGGCGCTCCTGTCGAGTTCCAAGACTGCGCATCTGG
TGAAGCAGAACGCGGCCAACGAGCACCTCTTCAAGAAGAGATTTGCTGAGGCTATGGTGAAGATGGGCAATATCGAAGTGCTCACTGGGAAAAAAGGAGAGATAAGATTGAACTGTAGGG
TGATCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCCGAGAATAAGTGGGGAGATAGTGTTCTTGGCCCTGGTGCTTGGCATGTGTCTCAGCGCTACGGCAGAAGCTACGCTTCGTGTCGGGTATTACCAAAATACATGTCCCCAAGCT
GAGTTCATCGTGAAGAAGGTTGTAAAGAAGGCGACGAAGAAGGACAAGGGTCTGCCCGCTGATTTCATCAGGATGCACTTCCACGACTGTTTCGTGAGG
GGTTGCGACGGATCAATTCTT
ATCGACTCCACCTCGAACAACACCGCCGAGAAGGACTCACCCATCAACAACCCAAGCCTGGAAGGGTTCGAGATCATCGACGAGGCCAAGGCCAAGCTGGAGAAGCAGTGCAAGGGTATC
GTGTCCTGCGCCGACATCCTCGCTTTTGCTGCCAGAGATAGTGTTAAGCTG
AGCGGGGGATTTTGGTATGAGGTCCCCTCGGGAAGGAGGGACGGGAGGATCTCCCGTAGCTCGGAGACA
TTCGGAAACTTACCGCCTCCGACTTTCAATTTATCACAGCTCACACAGAACTTTGCCAGCAAGGGTCTGAACAAGCACGACTTGGTCACCCTATCTG
GGGCGCACACCATCGGCAAGTCT
CATTGCACCAGCATCAACAGTCGGCTGCACAACTTCAGCTCGACAGCCACCACCGATCCGAGCTTAGATCCGGCTTACGCGAAGAAACTAAAGAAGAAGTGCCCCAAAGCGAGCACCGAC
ACGAGCCTGACAGTCCCAATGGACCCTCCCAGTCCTGAGGTCTTCGACTCCAGCTACTACAAAAATATCCTTGTTCACAAGGGCCTCTTCCAGTCAGACCAGGCGCTCCTGTCGAGTTCC
AAGACTGCGCATCTGGTGAAGCAGAACGCGGCCAACGAGCACCTCTTCAAGAAGAGATTTGCTGAGGCTATGGTGAAGATGGGCAATATCGAAGTGCTCACTGGGAAAAAAGGAGAGATA
AGATTGAACTGTAGGGTGATCAATTGA

Retrieve as FASTA