Entry information : SpolAPx-R (Spipo21G0000700)
Entry ID 13237
Creation 2015-06-09 (Christophe Dunand)
Last sequence changes 2015-06-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-06-17 (Christophe Dunand)
Peroxidase information: SpolAPx-R (Spipo21G0000700)
Name (synonym) SpolAPx-R (Spipo21G0000700)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolAPx-R
start..stop
S start..stop
VvAPx-R 364 8e-127 79..319 90..330
AfpAPx-R 364 1e-126 40..319 54..332
AcoAPx-R 362 4e-126 93..319 106..330
LeAPx-R 355 2e-123 80..317 88..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 66019..66217 199 N° 2 67023..67190 168 N° 3 67316..67386 71 N° 4 67604..67646 43
N° 5 67740..67836 97 N° 6 68184..68267 84 N° 7 69177..69301 125 N° 8 69431..69500 70
N° 9 69590..69692 103  
join(66019..66217,67023..67190,67316..67386,67604..67646,67740..67836,68184..682 67,69177..69301,69431..69500,69590..69692)


exon

Literature and cross-references SpolAPx-R (Spipo21G0000700)
Protein sequence: SpolAPx-R (Spipo21G0000700)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319
PWM (Da):   %s   34692.73  
PI (pH):   %s   8.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTAATTAVPSRFPFPRSRRTALRHPGDPRPRCPLRRRRTPTECLRGEQVENPCSSSSSSEGHRGTVHDVCLLIFAVSRAVESGESLLVRTEVRKVLSKSKAPGVLRLAFHDAGTFDMNDGTGGMNGSIILELDRPENAGLRRSVVLEKAKSELDKVQNVSWADLVAVAGAEAVSLCGGPVIPIQLGRMDTSIPDPEGKLPQESLGAFDLKKCFFEKGFSTQELVTLSGAHTLGGKGFGSPIVFDNTYYKILLERPWASSGSSMSSMVGLPSDHALVEDAECLRWITIYAADERKFFEDFKRAYIKLVNTGASWRNV

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). Incorrect prediction from Phytozome (two first exons are missing).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGGCAGTTCG CATCCAGCGG CGGAAGAAAT CGTCGGAGGC GCCTCTCCAC GATGGCTCCT CCGATGAGGA GGACATCTAC CTGGACAGCA TCTCCGGGAT GCCCGTACGC TTCACCTACG  GGGATCTCCG GCAGGCAACA GACGACTTCT CGGTGAAGCT CGGGAGCGGC GGCTTTGGGT CGGTGTACCT CGGTAAGCTT CGAGATGGGT CCCGAGTGGC AGTGAAGAAG CTGGAGGGCG  TACACCAGGG AACCAAGGAG TTCCGGGCGG AGGTCTCCAT CATAGGCAGC ATCCATCACA TCCATCTGGT CAGGCTCCGG GGCTTCTGTG CAGAGGGCAG CCACCGGCTT CTGGCTTACG  AGTACATGTC GAACGGATCG CTGGATAGGT GGATCTTCCG CAAGGACAAG GAAGGCCATC AGCTGGACTG GGAGAAGAGG TTCAACATCG CCCTGGGCAC GGCCAAAGGT CTGGCGTACC  TCCACGAGGA CTGCGAATCC AAGATCGTCC ACTGCGACAT TAAGCCGGAA AACGTCCTCC TGGACGACAA TTTTGAGGCC AAGGTCTCCG ATTTCGGGCT GGCAAAGATG ATGACCCGGG  AGCAGAGTCA TGTGTTCACG ACGATGAGGG GCACGAGGGG GTACCTCGCG CCGGAGTGGA TCACGAACTA CGCGATTTCG GAGAAGAGCG ACGTATACAG CTTCGGAATG GTGCTGCTGG  AGATCATTGG AGGCAGGAAG AACTTCGACC CGTCGGAGAC CTCGGAGAAG GCGCATTTCC CATCCTACGC TTTCAAGATG ATGGAGGAGG GGAAGCTGAG GGAGGTGCTG GACTCGACGC  TGCTGTTGAG CGACAAGGAC GACAGCGTGG AGACGACTAT TAAGGTGGCA TTGTGGTGCA TCCAGGAGGA CATGACGATC AGACCGTCCA TGGCCAAGGT CGTGCAGATG CTCGAAGGTC  TGACGGACGT TCCTCAGCCC CCGACATCCT CCCAGATGGG CTTCCGACTC TATGCGAATC TCATCAAGAC CATGAGCGAA GAGGGCTCCT CTGCCGCGTC GGGCCCCTCT GACTGGAACA  GTGAAGCCTT GCTATCGGCG GTGCGGCTGT CCGGACCCAG ATAGCAAGAG GTGTTACGAG GTGGGTTCCT GGCACCTCCG ATCCTGCGGA GCCCGCCGTC TCGCGGACGA GACCGCCGGA  GCCGACGGCA ACTTCTCTCC ATCGTCGGGT TGGGGTGCTT CCCCTCTTGT TGGAGAGGGC TCCGAATTCC ATTTAAATTT TCAATTCTTT ACTTTCGACG GAATCGGACC ATCATCGGGG  ACCTCCGCGG GTCTCCTGCT TGTCTGCGTC ACATCTTCTT GCTCAGACGC CCATTCTTGT TCTTCCGGGG ATTGTGGGTG GGCATTATTT CGAGTCGAGC TTCGAGGGCG ACGCCGGCGG  ACATCTCCAC TCCTCCCCAC TTGCTCTATC CTTTCGCAGC GCGACGGGAC CCGATTCCGT TTCCCATGCT TTCCAGCTCC AAAGTGCGTC CAGTTCCGGT GGACAAGTCC GAGACCGCCC  GACGCTCTTC CTCGCCCCTC CGTGTACGGC CGCTGGCCAT CTTGACCCCA GGGGATCGAG GCCCCCCAGC ATCGTCGTGA TATGATCCGC AATCTGCTGG CCTCGAGTCT CCTCCGGTGG  CCGAGGCGAC GCCAGGGTCT TTCTTTGTTT CCTTCCATCT AAGCGTGCCC GACGGGTACT ACCTCATCGT TCCCCGCTGA GAGGCCGGGA AGGTCCACAC ACACACACAC CCACGTACAG  CCCTGCCTCA ATAAACGGGC TTCTCTTCTT GCTACTTGGA ATTCAAACTG GCTCGAGGCT CATACCCCGT CCCAATGGGC TGACCTCGGA CGAAGTCCAG CCCGAGGTAT TTTAGCTTAA 
GCCTGGCCTC CCACCACCGC TCACGCCAAC CGACCGCAGG CTACCGCTGG TTTCTCCCGC TTCCCTTCCT CTTGCGGGGC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACCGCGGCGACCACCGCCGTCCCCAGCCGCTTCCCGTTCCCACGTTCAAGACGAACAGCGCTTCGGCATCCAGGAGACCCACGGCCACGCTGCCCACTCAGACGCCGCCGGACG
CCCACCGAGTGCCTGCGAGGGGAGCAAGTGGAGAACCCCTGCTCGTCCTCATCCTCCTCGGAAGGACACAGGGGCACAG
GTGACGATATCCCCTTTTTCCTCGCTGGATCCTCTTCAACA
CCATCCCCCTTCCCACAAGGAGCTCTCTCCTTCTACTGGACGAACAGCCATAATCATTCATGCACGGGCATATATTGACCCATGCCCGTACCTTTCATCGATAAAATTTCTATTTTGCGT
TGTGGATGCCACCTCTACAGAAAATTCGCCCCCCTTGCCTTTTTTTCATCTCTCCTTAGGTTTTATTTGCCCATAATTTGACTGCAGGGGAGAGCAGGTCCTTCGCCTTCTACGGAAGAA
GATTTTTCTTTCTGGCCACGGCTCCGTTGTTGCTCTCCAGTCAAGGCTCATCAGAATACTCCAATGCCAATTCACTACAGTATGTTTCATAATTTCCTTTCCGCTTCCTATCTTCCCTCT
GAGGCAGCGGCCTCCAAATCCGCCCGATTCCTTGAACCCTGCGAGACTAGTGTAGACATGAACCCGAGTTCTGTAGTTCGATGGTCTGCTGCCTCTCGGTTCCGCCATGCTGCTTCAGTT
TGACCGCATCCTTTCAAAACATTTTATACATCAATAAAGTAATAGAGGTCGATAAGTCACAAAAAACAATCTTAGAGATCAGTAAAGTTCTGGTAGAGTTGTGGCATCTTTCAAGAGACG
AGAGCAACGTGCCAGTTTGGTAGCAGCCCAGTGGGGTTCAAGCAATGCTCTCGACAGGTGATGTCGGCGAGCTTTTGCATGTGGCCACAAGGAGTGCTGGGCTAGATCAATGGCGCATAC
CAGGAGAAATTTAATTCCTTTCTTTTAAATTTCTGCACTTTGAGTACATGATGTCTGTCTTCTCATATTTGCTGTCAGCAGAGCAGTAGAGTCTGGCGAATCTTTGCTTGTTCGAACTGA
GGTAAGGAAAGTCCTTTCAAAGTCCAAAGCTCCTGGGGTACTTCGGTTGGCCTTCCATGATGCAGGGACATTTGACATGAATGATGGCACAG
GTTTATTTTGGAGCTAGAACTAGAGAAC
GTTTCATGTCTCTTACTTTTGTCTACTCTACCTTGAATGGTGTCACGCAACATCAGGCTGTCTTTTAATGGATTATATGCTTTACGTTTCCTTGCAGGTGGAATGAATGGCTCAATTATT
TTAGAACTTGATAGACCTGAAAATGCAGGTTTGCGTAGATCTGTGAAG
GTGTGTCTGTTTTTCATCCTCTCTTTCGTGCATGTTTACGTGTTCAAAAAATATTTTTGTCTAGTTGGTGAA
CATATATTATTGCTTCGTATCATGACCACCCACGCTCATTTTGGTGGATTATTACATGATATTATTTATGATTCTTCTTTTGTCGGTCTCTCCCTGTCTATTTATCCTCTTATCGACTCT
CCACTTTGTTTTCTTTTCTGATTAGGTTTTGGAAAAAGCAAAGAGCGAGTTGGATAAGGTTCAGAATGGTATGACTTTCCTATTCACTGTAATTCATGTGTTCCTGCACGTGATTATTCT
CTCCTCTTCTTGAAATTTATCATGGGTTACACTGGTGTCAGTGTCCTGGGCTGATTTGGTTGCTGTGGCTGGTGCGGAAGCCGTTTCGTTATGTGGAGGTCCCGTCATTCCTATTCAGTT
AGGCAGGATGGATACAAG
GTTAAATTTCACCTTACAAACATTGCACTCTTGCTAAGAAAAAAAAGAAGAAGAAGATGGATACAGGGTAATTAGTCCCGACTGTGTGATCAAATCGGTCGA
TGGCTGTTTATGTGAATAAAAATTATCGATAATGCCTCCTTGAATATCTTATGAATTTTTCTCTTCTGATACGTAATTTTGGGTTTCTTGGAGGTTTACTTTCACAAGCAGAAAAATTAA
AGCCGATGACCTGATCCCTTTCTTGGTTAAATTCTATATAATGACAGGTCTCACCCCTTTTTTAACGGATGGTCAGTCGCACCTGAACCACCAGTCTTCTAACCTTTGGATTTTCTATCA
TCCAGTATACCAGATCCCGAGGGAAAACTTCCCCAAGAGTCGCTGGGCGCTTTTGACTTAAAGAAGTGTTTCTTTGAGAAAGGCTTCTCGTGAGTAAATATTCTCATGCCATGGCATGGG
TTTTTTCTTTTCTTTTGCTTTTTCTCTTGTCTATGTTACTCTACCTGTTTTGCGTAATCAGCATAATTTAAACGGATAAATCTGTGTTTATTAATATGCTACAAGCTTTTCCATTTCACC
CGATTTTCTCTGCTGTATACTTGAAGGTTATAAGTTTTTTCCTTGTGCATGTATGATGTTCCTGGGGCCACTCAGCTCAAACTCCTCATGGGTAGGATGTAATTTGGTCCTCTGGTCATT
CTAGTCGAAAAATAACAGTCCAGCGTAGTCTGTGTATAGTAGAAATGATGCGCGTGAAGATGGTGCAAAGTCAGATTATGCTCTGTTCATATGATTTGATGTGGACCTACCAAGTCTTTT
ATTAAAGTCAGATTATGTCTCATGTTTACTGGGCACACGTTAGATGTGCGCAGAGTTCTTTTATAAAAAAAATAATAATGTCATGGGAATTCCGATAATGATGGGTTTTGCAGTGTATCA
GAGCTTTTCCACCGTCGAGAACTTGTGATATTTTTTGCAAACGTTCCATGTTGCTCTTATGTCTAGTATGTATGCCTCTGCATTCCTCTCCTCTATCGTCGACGATCAAGTTTGCTTTGC
TCAAATATGAATGACAAAACGCTTTGATTATTCCTTCGATTATTCCTGTGTTGTTTGGACCTGCAGTGTCAATAAAAGATTTTGGAAAGCCGTTGAACCTTGTCGAAATCGTCCAAATGC
TAAAGCCTAGAACGTCGTTTTTTGGCAAATTTGTCTTGTTATGTCAGCTGTTATTCAAGAGAACTTGCGGCGGCACGAGTCCGTCTCATGCCGCCGCGGGTTTTCTGTTGCGGCCATCCT
TTTGCTGCTGCAGTGTGAACTCGAGGGTCAAATTGCAGAACACAAGAACTGGTCACATTGTCTGGAGCTCATACGCTGGGAGGAAAAGGCTTTGGGAGCCCAATCGTCTTCGACAACACC
TACTACAAGATACTCTTGGAGAGACCGTGGGCGTCGTCCTCCG
GTGAGTAGCCAGATGCCCGTCTGTGCAAATTGACCGCATTTATTCTCCTCTGGGGATCTCATTTGGCGGCGCTTTTT
TCCTCCGCGGACTGCGACTTATGGTGGCCGGGCCTTTCTGCTGCAGGCTCAGGCTCTTCCATGTCGAGCATGGTCGGGCTCCCATCAGACCATGCGCTCGTCGAGGATGCCGAATGTCTG
AG
GTCCCTACTGATGGCATTGGTCTCTCTTTCATTCCCGGCGCACTGCACCGGGGGGCTTGATGTCTGAGGCGCCTTGCTTGCTGTTGCAGGTGGATCACGATTTACGCAGCTGATGAGA
GAAAGTTTTTTGAAGATTTCAAGAGGGCGTACATTAAACTGGTCAACACCGGCGCGTCGTGGAGAAATGTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACCGCGGCGACCACCGCCGTCCCCAGCCGCTTCCCGTTCCCACGTTCAAGACGAACAGCGCTTCGGCATCCAGGAGACCCACGGCCACGCTGCCCACTCAGACGCCGCCGGACG
CCCACCGAGTGCCTGCGAGGGGAGCAAGTGGAGAACCCCTGCTCGTCCTCATCCTCCTCGGAAGGACACAGGGGCACAG
TACATGATGTCTGTCTTCTCATATTTGCTGTCAGCAGAGCA
GTAGAGTCTGGCGAATCTTTGCTTGTTCGAACTGAGGTAAGGAAAGTCCTTTCAAAGTCCAAAGCTCCTGGGGTACTTCGGTTGGCCTTCCATGATGCAGGGACATTTGACATGAATGAT
GGCACAG
GTGGAATGAATGGCTCAATTATTTTAGAACTTGATAGACCTGAAAATGCAGGTTTGCGTAGATCTGTGAAGGTTTTGGAAAAAGCAAAGAGCGAGTTGGATAAGGTTCAGAAT
G
TGTCCTGGGCTGATTTGGTTGCTGTGGCTGGTGCGGAAGCCGTTTCGTTATGTGGAGGTCCCGTCATTCCTATTCAGTTAGGCAGGATGGATACAAGTATACCAGATCCCGAGGGAAAA
CTTCCCCAAGAGTCGCTGGGCGCTTTTGACTTAAAGAAGTGTTTCTTTGAGAAAGGCTTCTC
AACACAAGAACTGGTCACATTGTCTGGAGCTCATACGCTGGGAGGAAAAGGCTTTGGG
AGCCCAATCGTCTTCGACAACACCTACTACAAGATACTCTTGGAGAGACCGTGGGCGTCGTCCTCCG
GCTCTTCCATGTCGAGCATGGTCGGGCTCCCATCAGACCATGCGCTCGTCGAG
GATGCCGAATGTCTGAG
GTGGATCACGATTTACGCAGCTGATGAGAGAAAGTTTTTTGAAGATTTCAAGAGGGCGTACATTAAACTGGTCAACACCGGCGCGTCGTGGAGAAATGTCTAG

Retrieve as FASTA