Entry information : SpolPrx36 ( Spipo0G0119900)
Entry ID 13239
Creation 2015-06-09 (Christophe Dunand)
Last sequence changes 2015-06-09 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-24 (Catherine Mathe)
Peroxidase information: SpolPrx36 ( Spipo0G0119900)
Name (synonym) SpolPrx36 ( Spipo0G0119900)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolPrx36
start..stop
S start..stop
MguPrx76 371 2e-129 21..324 30..331
ThasPrx44 370 1e-128 9..325 35..347
AtPrx43 369 1e-128 1..325 1..326
CsaPrx92 364 7e-127 17..325 21..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8260526..8260723 198 N° 2 8260793..8260978 186 N° 3 8261061..8261223 163 N° 4 8261329..8261759 431
join(8260526..8260723,8260793..8260978,8261061..8261223,8261329..8261759)


exon

Literature and cross-references SpolPrx36 ( Spipo0G0119900)
DNA ref. Phytozome 12:   pseudo0 (8260526..8261759)
Cluster/Prediction ref. Phytozome Gene 12:   31508096
Protein sequence: SpolPrx36 ( Spipo0G0119900)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (306)
PWM (Da):   %s   34346.09 (32205.0)  
PI (pH):   %s   4.78 (4.78) Peptide Signal:   %s   cut: 20 range:20-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVWWSAGLLLALLVGSSWGKLEVGFYRQSCPAAEEIVRSVVGEATAGDPTTAAALLRLHFHDCIVQGCEGSVLIFRPDGKQENMAFGNEGLRGFDVIERAKSRLEAACPGVVSCSDILALAARDSIVLSNGPRYDVPTGRRDGRVSNISDGDNLPDVNDSAAVLLAKFAQKGLSDNDLVLLSAAHTIGTAACFFMNDRLYNFQGSAGPDPSISWFFLPALMETCPRGGDPNARLPLDGGGAAGEFTFDDSILWNIAGGAAVLQSDAALYGDPSTRAIIDSYLRHRRSAVDGGFAADFAAAMVRMGRIGALTGSQGEIRRVCSSFN*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTATCTCA AATTAGATAG ATCGCCATAA ATATAAATAT CACATTCGTT AGTCAGATTA CCACATTCTT TGCTTTCTTT TTAGCCTGGC AAGTTTGAAG AAATATGACG CTGAGATGCC  GATCTTCCTA GAGCGACGAT AATTACCCAA AAAATAAGTT TTTAGTAAAA TATAAGTCGC TTAATATCCA GACAAAATTA GGAACGTGAA TGAGCTCGGG CCTCCATTTT CCTTGTCCTT  GTCTTGCACC AACTCTCCTC ATCACCCTTC CTCTTCCTCC TCGTTCCACA GGCCTTAGAC ACGAGAGGAT TCCACGAGGG CCTCTTCATG CAGGCGAGGA CGGAAAGATA GCCCCTTGAT  CATCGCCCTC CGACGGCGCC ACCTCTATCT TCTGCTACAG CATCTCTATT GCATCCTTGG GTACTCCGGA ATCACAGCGT GGGGAGATCA CCATGTTCGA GCGGAAGGTA ATTCACAGCA  AGAAGAATAG AGCCAGGCAC TCTGGAGAAG CTCTGAGCTG ATCTCCCGCG GCGTCTGTTA GATCACCCTC AGCAGCAGGT CTCTCACTCT GTCGCCGGCG ACCGCACAGT CGCCCCTCAC  CTTGGTTGTT CGCGTCGAAA GGAACAAGAG AAGGCCGTCC GTCAGTTCTC CGCCGGAGGA CGAAGGTGGG GTGGGGGATC AGCGCTGAGA ATGGCCATCT CCTCACCTCC ATGCAGAGGA  GAATCCGAGA GACACCGGAG AGCGTGAAGA AGTTGACGCC GGTCACCTCC AGGCCGAGGG TGGTCATGGC TTCCGCCAGC TTCGCCAGGG CGCCCTTCCT TTTCCTGCAG ACTATGCTGG  CCCCGAGCCT GTTCTTGCCG AGGGGCCTCA CCTCCACCTC CTCCTGCAAC AAGAGCTCGA GAAGCCGAGG GAGAATTAGG CCGTCGCCTG GTTCAGATGA ATGGGCCGTG GCCGGGGAGG  AACCTTGCAG TCGACGGGTT CTGGCGGGGG CCTCTCCTCG GGGCTAGAGG CGCTCCCCTG GAGCTCCACT TCCGCGTCTG CTATCTCCTG CAATTCCCTC TGGAGCTCTT CCTTCCGGCC  GCGAAGCTCC TGGATGTAGT CGATCGCATC GGCGAGGGTG GACTCCTTGC TCATCTGCGG GGCAAAGCGC GGTCGATCGC TAACAGCGGA GCCTAAAATG GCGGGAGCTA GGGTTTTCTC  TCGCATGCCT TGGTTATCCT GGGAACCAGG GAGCGGAGAG CGAAGAACTG GCCCTTCAGC TTGGCTCTTC GCTTCCTTTC GGCCTCCAGA TTCTTCGACT TGTACACAAT CTCCGGCGTC  ACGCCGCCGG GGTGCTGGGT GCGCTCGGCG GCGGCGCCGC CCAGAAGCCC CGCCACGAGG TATCCCCCGC AGTCGTGGTC GGCGGCACCC GTCCCCCACC GCTGTTGCCG CGGCATCTCC  CCTCTCCAGG CGGCGCCACC AGCGGAGAGT CGGGCCTCTT TCTCAGGTCG CATTTGTAGA AAAGGCCGGG GATTCTCTCA TGGCGAACGG GCAGCTAGGG TTAGTTGGGC ACAAGGAGGG  GAAGCACCTC CATTGCGAAC CATGGCGGTT GAGTCTGTTC CTCCGTACCG ATTCCCCTCT CTGTCCGGCT CTCTGCGAGA AGTTGATATC AGGGTTCTTC CGATCTGGAT CCAACGGTGG  AGAGGGACGA TGCCTCGGCC ATCTCAGCCG CCTCGCCGAC CTCGTCTCAG TGAAATCAGG CATCCTCACC ATCAACGCTC TGCTCGGGGG GGTACTGCAG GGAGGGGAGC CTGGGCAGCG  CGAAGAAGGT GTTCGACGAA TTGCCCGGAG CGGCTGCCTT ACAAATCGTG nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn TCTCTCTCTC TCTCTCTCTC TCTCTCTCTC TCTCTCTCTC TAGAAGGGCC ATGGTGTGGT GGTCAGCTGG CCTGCTGCTG GCGCTCCTGG  TGGGGAGCTC ATGGGGGAAA CTGGAAGTGG GGTTCTACCG GCAGAGCTGC CCCGCGGCGG AGGAGATAGT GAGGTCGGTG GTGGGGGAGG CCACCGCCGG CGACCCCACA ACGGCGGCGG  CGCTGCTGCG GCTCCACTTC CACGACTGTA TCGTCCAGGT AAGCCTACGC CGCCGCCTTC CCGTCCTCGG ATGTGGGAAC GGCTGACGGT TGCTAGAATT CTCACAGGGC TGCGAGGGGT  CGGTGCTGAT ATTTCGGCCG GATGGGAAGC AGGAGAACAT GGCCTTCGGC AACGAGGGGC TCCGGGGATT CGACGTCATC GAAAGGGCCA AGTCCCGGCT GGAGGCGGCC TGCCCCGGAG  TCGTCTCCTG TTCCGACATT CTCGCGCTGG CGGCGCGGGA CTCTATCGTC CTGGTCAGAG ACTTCTCTAC CTTCTCTCTC TCTCTTCTCT CTTCTCTCTC TCTATCTCTC TAGGAAGGTG  ACGGTATGCG AGCAGAGCAA CGGGCCGAGA TACGATGTGC CCACGGGGAG GCGTGACGGC CGGGTCTCCA ACATCTCCGA TGGGGATAAT TTGCCCGACG TGAACGATTC TGCCGCCGTT  CTCCTGGCCA AGTTTGCCCA GAAGGGCCTC TCCGACAACG ACTTAGTCCT CCTCTCCGGT CTCTCTCTCT CTCTCTCTCT CTCTCTCTCT CCCCCCTTTT TCTCTCTTAT TCTGGGTCTT  CCTCTCCGGT CTCCTCTCTC TTAATCTTGT CCAACTCCGG CAGCGGCGCA TACGATCGGA ACGGCGGCGT GCTTCTTCAT GAATGACCGC CTGTACAACT TCCAGGGCAG CGCCGGCCCC  GATCCGTCCA TCAGCTGGTT CTTCCTCCCG GCGCTCATGG AGACCTGCCC CCGTGGCGGC GACCCCAACG CCCGCCTCCC CCTCGACGGC GGCGGCGCCG CCGGCGAGTT CACCTTCGAC  GACAGCATCC TCTGGAACAT CGCCGGCGGT GCCGCGGTGC TCCAGTCGGA TGCTGCCCTC TATGGCGACC CCTCCACCAG GGCCATCATC GACTCCTACC TCCGCCATCG GAGGTCCGCC 
GTCGATGGGG GCTTCGCCGC CGACTTCGCG GCGGCGATGG TGAGGATGGG CCGGATCGGT GCCCTCACGG GCTCCCAGGG GGAGATCAGG CGCGTCTGCT CCTCTTTCAA CTGA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTGGTGGTCAGCTGGCCTGCTGCTGGCGCTCCTGGTGGGGAGCTCATGGGGGAAACTGGAAGTGGGGTTCTACCGGCAGAGCTGCCCCGCGGCGGAGGAGATAGTGAGGTCGGTG
GTGGGGGAGGCCACCGCCGGCGACCCCACAACGGCGGCGGCGCTGCTGCGGCTCCACTTCCACGACTGTATCGTCCAG
GTAAGCCTACGCCGCCGCCTTCCCGTCCTCGGATGTGGGAAC
GGCTGACGGTTGCTAGAATTCTCACAGGGCTGCGAGGGGTCGGTGCTGATATTTCGGCCGGATGGGAAGCAGGAGAACATGGCCTTCGGCAACGAGGGGCTCCGGGGATTCGACGTCATC
GAAAGGGCCAAGTCCCGGCTGGAGGCGGCCTGCCCCGGAGTCGTCTCCTGTTCCGACATTCTCGCGCTGGCGGCGCGGGACTCTATCGTCCTG
GTCAGAGACTTCTCTACCTTCTCTCTC
TCTCTTCTCTCTTCTCTCTCTCTATCTCTCTAGGAAGGTGACGGTATGCGAGCAGAGCAACGGGCCGAGATACGATGTGCCCACGGGGAGGCGTGACGGCCGGGTCTCCAACATCTCCGA
TGGGGATAATTTGCCCGACGTGAACGATTCTGCCGCCGTTCTCCTGGCCAAGTTTGCCCAGAAGGGCCTCTCCGACAACGACTTAGTCCTCCTCTCCG
GTCTCTCTCTCTCTCTCTCTCT
CTCTCTCTCTCCCCCCTTTTTCTCTCTTATTCTGGGTCTTCCTCTCCGGTCTCCTCTCTCTTAATCTTGTCCAACTCCGGCAGCGGCGCATACGATCGGAACGGCGGCGTGCTTCTTCAT
GAATGACCGCCTGTACAACTTCCAGGGCAGCGCCGGCCCCGATCCGTCCATCAGCTGGTTCTTCCTCCCGGCGCTCATGGAGACCTGCCCCCGTGGCGGCGACCCCAACGCCCGCCTCCC
CCTCGACGGCGGCGGCGCCGCCGGCGAGTTCACCTTCGACGACAGCATCCTCTGGAACATCGCCGGCGGTGCCGCGGTGCTCCAGTCGGATGCTGCCCTCTATGGCGACCCCTCCACCAG
GGCCATCATCGACTCCTACCTCCGCCATCGGAGGTCCGCCGTCGATGGGGGCTTCGCCGCCGACTTCGCGGCGGCGATGGTGAGGATGGGCCGGATCGGTGCCCTCACGGGCTCCCAGGG
GGAGATCAGGCGCGTCTGCTCCTCTTTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTGGTGGTCAGCTGGCCTGCTGCTGGCGCTCCTGGTGGGGAGCTCATGGGGGAAACTGGAAGTGGGGTTCTACCGGCAGAGCTGCCCCGCGGCGGAGGAGATAGTGAGGTCGGTG
GTGGGGGAGGCCACCGCCGGCGACCCCACAACGGCGGCGGCGCTGCTGCGGCTCCACTTCCACGACTGTATCGTCCAG
GGCTGCGAGGGGTCGGTGCTGATATTTCGGCCGGATGGGAAG
CAGGAGAACATGGCCTTCGGCAACGAGGGGCTCCGGGGATTCGACGTCATCGAAAGGGCCAAGTCCCGGCTGGAGGCGGCCTGCCCCGGAGTCGTCTCCTGTTCCGACATTCTCGCGCTG
GCGGCGCGGGACTCTATCGTCCTG
AGCAACGGGCCGAGATACGATGTGCCCACGGGGAGGCGTGACGGCCGGGTCTCCAACATCTCCGATGGGGATAATTTGCCCGACGTGAACGATTCT
GCCGCCGTTCTCCTGGCCAAGTTTGCCCAGAAGGGCCTCTCCGACAACGACTTAGTCCTCCTCTCCG
CGGCGCATACGATCGGAACGGCGGCGTGCTTCTTCATGAATGACCGCCTGTAC
AACTTCCAGGGCAGCGCCGGCCCCGATCCGTCCATCAGCTGGTTCTTCCTCCCGGCGCTCATGGAGACCTGCCCCCGTGGCGGCGACCCCAACGCCCGCCTCCCCCTCGACGGCGGCGGC
GCCGCCGGCGAGTTCACCTTCGACGACAGCATCCTCTGGAACATCGCCGGCGGTGCCGCGGTGCTCCAGTCGGATGCTGCCCTCTATGGCGACCCCTCCACCAGGGCCATCATCGACTCC
TACCTCCGCCATCGGAGGTCCGCCGTCGATGGGGGCTTCGCCGCCGACTTCGCGGCGGCGATGGTGAGGATGGGCCGGATCGGTGCCCTCACGGGCTCCCAGGGGGAGATCAGGCGCGTC
TGCTCCTCTTTCAACTGA

Retrieve as FASTA