Entry information : SpolPrx42 ( Spipo6G0060300)
Entry ID 13245
Creation 2015-06-09 (Christophe Dunand)
Last sequence changes 2015-06-09 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-24 (Catherine Mathe)
Peroxidase information: SpolPrx42 ( Spipo6G0060300)
Name (synonym) SpolPrx42 ( Spipo6G0060300)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolPrx42
start..stop
S start..stop
VvPrx35 462 2e-165 11..321 15..326
GmPrx188 458 3e-164 10..321 5..316
VvPrx21 455 1e-162 15..321 10..315
GmPrx52 453 6e-162 10..321 5..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5382443..5382664 222 N° 2 5381742..5381933 192 N° 3 5381488..5381653 166 N° 4 5380563..5380948 386
complement(join(5380563..5380948,5381488..5381653,5381742..5381933,5382443..5382 664))


exon

Literature and cross-references SpolPrx42 ( Spipo6G0060300)
DNA ref. Phytozome 12:   pseudo6 (5382664..5380563)
Cluster/Prediction ref. Phytozome Gene 12:   31505911
Protein sequence: SpolPrx42 ( Spipo6G0060300)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (294)
PWM (Da):   %s   34153.76 (31133.2) Transmb domain:   %s   i13-32o
PI (pH):   %s   7.88 (7.93) Peptide Signal:   %s   cut: 28 range:28-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASVTGVRGNLELCFLFFVFFLSLASGQLSSTYYDSSCPKALSTIRSAVRDAVAKERRMGASLLRLHFHDCFVNGCDGSVLLDDTASFTGEKTAGPNDRSLRGFDVVDSIKSQVESVCPQVVSCADILAVAARDSVVALGGPSWTVKLGRRDSTTASLSNANNDLPGPTSDLSTLISAFAKKGLSSSDMVALSGSHTIGQARCTTFRSRVYNDSNINSSFATSKQSSCPRSGSDDQLSPLDTSTPSFFDGCYYKNLVGNKGLLHSDQELFNGGSTDSQVSNYAKNPTKFFTDFATAMVKMGSISPLLSPSGEVRVNCRKTN*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCTCTCTCTC ACACACACAC ACACACCCCA CCCCACCCCC ACCTCCCATC CCTCTCTCTT ACTTTCAAAA TCTTTCCTCT TTTCCTCAAT GATACATCTC TTTATTATCA AAAGATGGTA  TTTCTATCAA TCTATGATAA GAAATAATTA AAAACCTTAT ATATGTTTAT TTTAGTGTTA GAAAGATGAA AGAATGATAA TAGGATAAGA AAAAATCTTA TTGCCTAATT CTCATAGGTA  TTCGTCTAGA AAAATAAAGA TGTACACGTA ATGTAATTTA AATTTCTTGC AAACTTATCA AAAACATTAG GCTATGCAGT TTAGGATGAG CCCAAACATT TCAAAAAGTA GGGTGTTGAC  CAATGGGTTA TTGGTATGAT TCGAATATTA TTGGTTGACT ACCCATCCCA CACTTCTTGC GTTCATAGTG GAGGACCCCA CCACCATGAA AAAAGCGAAA ACGTGGAAAG CACAGTAGTA  GACGTAGGAT TGAAAGCTGA GAATACCTTA AGAGTGCATG TGGACGACTC GGCACCTTGC TAAAAAGGCA TATTTTATAT TGTTCTTCCA TGAATATCAC ATCTACTAAA ATAATTAAGA  ATCATATGAT AGTATCCATA TCGTCATTTC ATAAATTTCA TTTTAGAGAT ATTTCAGATC AAATCCAAGG GATCTGGGTA TGGGCATGTA AGCTTAGAGT CTAGCTTGAC CTGATTGTCA  TCAGCTAAGA GACATAGGTA AGCCCATCCT AAAATAAGAA CATGGCCGTT CTAATTGGAT CCGTCTTAGG ACTTCACTAG TCTCTTTTCT ACATATCATG AGCTAATTTC TCGTTAGGTG  ACTGTCTCAT GGTTACCTAC GTGAGACCTA GTATCAGGGA CAAAGTAGTC TGGCGCTAAT CACAGTGATA CGAATGTCTG TTCGGCTCCT GAATTCAAGA AATACGTGGG CGCTCTCCTT  GCTTGCTGAC CCGAAATTGA ATACGAACCA GGGTTAAGGT TACGCTAGAC TGAGTTCTTG ATGGAAGAAG TTGATCTGAC CGGTGAAGCT GCACGCATTG TACCTGTTTC TTCGATATTC  GAATAAATAT GAGTGTCAAA CTTCCCTTCG CGTACCTTCA CAAGCTGAAA ATTATTATAA CATGTATGGT TGTTTGGGGA CTAAGTATCG TTTCACTCTT GGTTTGGATG TACGAACAAA  ACTTTTAGAA GCCTCAATTG GGTATCCCCG TCCTCACTTC GTAATGAAAA TGGACCACAA CAACAGTTTA AGGATAAGAT CTTTCAATCC ATACGCGTAC GTCGAAAGAG ACCATGAATT  TGGATTTTGT ATGGAACCCT TTACATATAA TGTAAAAAGA AGTTTGCCAA AGTTCCTTTC CACCGTGCAT GTCCCCACGG CACAAAGTCA TGAAAGAAAG GGCTTTTGAA TGACGGTCTC  TACGGTAGGT TCGAAGTTCG GCAGGGTAGC ATGCTTGCCT TATAAACAAC AAGAATACAG ATCAACGCGT GCCTTAGTTA ATTGACTTGA GAGGGGATCA GTTAAAGCTG CCCAATGTGA  CCCTCAAGTC GACGATCAAG AGCTGAGATC TTCCGAATCT GACGAAGAGA AGTCCACTAT CCACGAAACC ACCCAGACAC TTCTCTCTTC TTGATACCAA TGAGGTCTTC TTACGTAACG  AATATGGACT CATGAAGTCC ATCTTTCTCG TGGCCTCCAC TAGGGCTCTA CCGTTCTCCG GATCTCCTCA TTGTGAGGGT TGGCGGGATT AGATCTCCTC TATCATTATC CTATGGTCAG  GATGGGCAGG CCCCACCTTC CATTTTTTTA TCTCCAAAGC TTTGACGACG GAGGCGAGGT TTTGGCTTAG TGGGAGGAAC GAGGCGGCTG GCAGTGATAG GTCCAGCCAG AAGGCAACGT  CTGCACCTTA TATAACTACA TGTCACTCGA CGGTTTCATG CTGCACCTAT GCTCTCCCCT CCTCGAGCTC TTCTTTGGCC ATGGCTTCCG TCACTGGCGT CCGTGGTAAC CTTGAGTTAT  GCTTCCTCTT CTTCGTCTTC TTCCTCTCCC TAGCCTCAGG TCAACTGTCT TCAACTTACT ACGACTCCTC CTGCCCCAAG GCCCTTTCTA CGATCCGATC TGCAGTCAGA GATGCAGTGG  CCAAGGAACG CCGCATGGGG GCCTCACTGC TTCGCCTCCA CTTCCACGAC TGCTTTGTGA ATGTAGGTCC TCTCCTAGAG AAGTCTCTGG TATTAATATT AGAGTGTATC ATCGAGCTCA  TAGCATGCTA TCGTAACAGA GACAACACAG AAAGCCTACC CGTTCCTCTC CCTTCCCCTT CTTCCCTTTT CAGGGCTCCA CGTTCGAACC CAAGCACCAA ACCTTAATCC CGTACATATC  GCGACTAAAT CATGACGTTA ATCGTGGGAC GGGCTCTTCG AGGTCTTAGA AGAAAATCTA ATAGAAGCTA GTTGTTGAGG GTCCCATGGA TATCACTACT AGTATTGAAC CCTGTCTGAA  GAGTTGTTTT ACTGGGTATT CACTCATGTT TGTCGACGTT TTACAACAAC TAGTAATCTA GAAACTACTA CGATTAAGGA TGCTTTTAAT TTATATTTTG CCCATGGAAA TTGACAAACT  GTAAGGGGAG ATATGAGGGC TTTCATCCAT CTGTTCCCAT TGACTGATAG CGGAAAGAAG TCTTGTGACT GGAGATTCTT CTCGATGGTA GGGTTGCGAT GGATCCGTTC TCCTTGATGA  CACGGCCAGC TTCACGGGAG AGAAGACGGC AGGACCCAAC GACCGGTCCT TGCGAGGCTT CGACGTGGTC GACTCCATTA AGTCCCAGGT GGAGAGCGTC TGCCCTCAAG TCGTCTCCTG  TGCCGACATC CTCGCAGTCG CAGCTCGGGA TTCAGTCGTC GCGGTAAGGA ACCGCCATTT ATCTTCCTCC GTAAGAAGAA CCCCAAAACT AAGTTTTGAT TGGGAATCTT GTACTTCCTT  TGGGAGCGCA GCTGGGGGGC CCTTCGTGGA CAGTGAAGCT GGGAAGAAGA GACTCAACGA CGGCCAGCCT GAGCAACGCC AACAACGACC TTCCTGGGCC GACATCGGAC CTCAGTACCC  TCATATCTGC CTTCGCCAAG AAGGGTCTCT CATCGAGCGA TATGGTCGCC TTATCAGGTA CAAAACTCTC TCATTCCGGG ACTCGATCCG TTAGCACGTC CATGTCAGGG AATCAGATCA  TTGAAATAGA AGTCAATTGG TGATAAGTAG ATCAGATAAT CTATTTTCAA AATAAAATAG AATCCCCTCG GTGAGTGTGA AGTATTTCCA CACGTGAGCA ATTTGACTTT AGATGGTTGC  CATGTAGACA ACATAGAAAT GTCATTTTAT CTAAAACTAA GTTTTGAGGA GTCGGATCAT TAACTCTTAA TCGATTGATG ATAAGCAGAG TGAACTCGTG CACGTAATTC AAATATCCCC  GCTCACATTT TAGTTGAGTT TTTAAATGAG TTCCATATGC GTTGAATGCC GACGGGATGC ATCATCTATG ATAAAAACCA GAATCTTGAT ACCATGGATT TGATTCCACT CAAAAGAAAT  TGGAATTATA ATCATTGGCC CTTATATTTT AACCGAAAGT TTAGCTATCT TATTCAATGT GGAAGACTAT TCGAACGGCA TGTCCTAATC GCGTTTGCCT ATGTTGGATT CCGAAGGATC  ACACACCATT GGACAGGCAA GGTGCACGAC GTTTCGCAGT AGAGTGTATA ACGACAGCAA CATCAACTCT TCATTTGCGA CATCAAAGCA GTCCAGCTGC CCCAGATCTG GTAGCGACGA  CCAGCTTTCA CCCCTCGACA CCTCGACACC TTCCTTCTTT GACGGCTGTT ACTACAAGAA CTTAGTAGGC AACAAGGGTC TTCTCCACTC GGACCAGGAG CTCTTCAATG GGGGTTCTAC  GGATTCCCAG GTTAGCAACT ACGCCAAGAA TCCAACGAAG TTCTTCACCG ACTTCGCGAC GGCTATGGTG AAGATGGGGA GCATCAGCCC TCTCCTGTCT CCGAGCGGGG AAGTCAGAGT 
CAACTGTAGG AAGACAAACT GA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGTCACTGGCGTCCGTGGTAACCTTGAGTTATGCTTCCTCTTCTTCGTCTTCTTCCTCTCCCTAGCCTCAGGTCAACTGTCTTCAACTTACTACGACTCCTCCTGCCCCAAG
GCCCTTTCTACGATCCGATCTGCAGTCAGAGATGCAGTGGCCAAGGAACGCCGCATGGGGGCCTCACTGCTTCGCCTCCACTTCCACGACTGCTTTGTGAAT
GTAGGTCCTCTCCTAGAG
AAGTCTCTGGTATTAATATTAGAGTGTATCATCGAGCTCATAGCATGCTATCGTAACAGAGACAACACAGAAAGCCTACCCGTTCCTCTCCCTTCCCCTTCTTCCCTTTTCAGGGCTCCA
CGTTCGAACCCAAGCACCAAACCTTAATCCCGTACATATCGCGACTAAATCATGACGTTAATCGTGGGACGGGCTCTTCGAGGTCTTAGAAGAAAATCTAATAGAAGCTAGTTGTTGAGG
GTCCCATGGATATCACTACTAGTATTGAACCCTGTCTGAAGAGTTGTTTTACTGGGTATTCACTCATGTTTGTCGACGTTTTACAACAACTAGTAATCTAGAAACTACTACGATTAAGGA
TGCTTTTAATTTATATTTTGCCCATGGAAATTGACAAACTGTAAGGGGAGATATGAGGGCTTTCATCCATCTGTTCCCATTGACTGATAGCGGAAAGAAGTCTTGTGACTGGAGATTCTT
CTCGATGGTAGGGTTGCGATGGATCCGTTCTCCTTGATGACACGGCCAGCTTCACGGGAGAGAAGACGGCAGGACCCAACGACCGGTCCTTGCGAGGCTTCGACGTGGTCGACTCCATTA
AGTCCCAGGTGGAGAGCGTCTGCCCTCAAGTCGTCTCCTGTGCCGACATCCTCGCAGTCGCAGCTCGGGATTCAGTCGTCGCG
GTAAGGAACCGCCATTTATCTTCCTCCGTAAGAAGAA
CCCCAAAACTAAGTTTTGATTGGGAATCTTGTACTTCCTTTGGGAGCGCAGCTGGGGGGCCCTTCGTGGACAGTGAAGCTGGGAAGAAGAGACTCAACGACGGCCAGCCTGAGCAACGCC
AACAACGACCTTCCTGGGCCGACATCGGACCTCAGTACCCTCATATCTGCCTTCGCCAAGAAGGGTCTCTCATCGAGCGATATGGTCGCCTTATCAG
GTACAAAACTCTCTCATTCCGGG
ACTCGATCCGTTAGCACGTCCATGTCAGGGAATCAGATCATTGAAATAGAAGTCAATTGGTGATAAGTAGATCAGATAATCTATTTTCAAAATAAAATAGAATCCCCTCGGTGAGTGTGA
AGTATTTCCACACGTGAGCAATTTGACTTTAGATGGTTGCCATGTAGACAACATAGAAATGTCATTTTATCTAAAACTAAGTTTTGAGGAGTCGGATCATTAACTCTTAATCGATTGATG
ATAAGCAGAGTGAACTCGTGCACGTAATTCAAATATCCCCGCTCACATTTTAGTTGAGTTTTTAAATGAGTTCCATATGCGTTGAATGCCGACGGGATGCATCATCTATGATAAAAACCA
GAATCTTGATACCATGGATTTGATTCCACTCAAAAGAAATTGGAATTATAATCATTGGCCCTTATATTTTAACCGAAAGTTTAGCTATCTTATTCAATGTGGAAGACTATTCGAACGGCA
TGTCCTAATCGCGTTTGCCTATGTTGGATTCCGAAGGATCACACACCATTGGACAGGCAAGGTGCACGACGTTTCGCAGTAGAGTGTATAACGACAGCAACATCAACTCTTCATTTGCGA
CATCAAAGCAGTCCAGCTGCCCCAGATCTGGTAGCGACGACCAGCTTTCACCCCTCGACACCTCGACACCTTCCTTCTTTGACGGCTGTTACTACAAGAACTTAGTAGGCAACAAGGGTC
TTCTCCACTCGGACCAGGAGCTCTTCAATGGGGGTTCTACGGATTCCCAGGTTAGCAACTACGCCAAGAATCCAACGAAGTTCTTCACCGACTTCGCGACGGCTATGGTGAAGATGGGGA
GCATCAGCCCTCTCCTGTCTCCGAGCGGGGAAGTCAGAGTCAACTGTAGGAAGACAAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGTCACTGGCGTCCGTGGTAACCTTGAGTTATGCTTCCTCTTCTTCGTCTTCTTCCTCTCCCTAGCCTCAGGTCAACTGTCTTCAACTTACTACGACTCCTCCTGCCCCAAG
GCCCTTTCTACGATCCGATCTGCAGTCAGAGATGCAGTGGCCAAGGAACGCCGCATGGGGGCCTCACTGCTTCGCCTCCACTTCCACGACTGCTTTGTGAAT
GGTTGCGATGGATCCGTT
CTCCTTGATGACACGGCCAGCTTCACGGGAGAGAAGACGGCAGGACCCAACGACCGGTCCTTGCGAGGCTTCGACGTGGTCGACTCCATTAAGTCCCAGGTGGAGAGCGTCTGCCCTCAA
GTCGTCTCCTGTGCCGACATCCTCGCAGTCGCAGCTCGGGATTCAGTCGTCGCG
CTGGGGGGCCCTTCGTGGACAGTGAAGCTGGGAAGAAGAGACTCAACGACGGCCAGCCTGAGCAAC
GCCAACAACGACCTTCCTGGGCCGACATCGGACCTCAGTACCCTCATATCTGCCTTCGCCAAGAAGGGTCTCTCATCGAGCGATATGGTCGCCTTATCAG
GATCACACACCATTGGACAG
GCAAGGTGCACGACGTTTCGCAGTAGAGTGTATAACGACAGCAACATCAACTCTTCATTTGCGACATCAAAGCAGTCCAGCTGCCCCAGATCTGGTAGCGACGACCAGCTTTCACCCCTC
GACACCTCGACACCTTCCTTCTTTGACGGCTGTTACTACAAGAACTTAGTAGGCAACAAGGGTCTTCTCCACTCGGACCAGGAGCTCTTCAATGGGGGTTCTACGGATTCCCAGGTTAGC
AACTACGCCAAGAATCCAACGAAGTTCTTCACCGACTTCGCGACGGCTATGGTGAAGATGGGGAGCATCAGCCCTCTCCTGTCTCCGAGCGGGGAAGTCAGAGTCAACTGTAGGAAGACA
AACTGA

Retrieve as FASTA