Entry information : SpolPrxQ01 ( Spipo20G0009000)
Entry ID 13249
Creation 2015-06-19 (Christophe Dunand)
Last sequence changes 2015-06-19 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-24 (Catherine Mathe)
Peroxidase information: SpolPrxQ01 ( Spipo20G0009000)
Name (synonym) SpolPrxQ01 ( Spipo20G0009000)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolPrxQ01
start..stop
S start..stop
VvPrxQ 309 2e-108 3..218 2..217
PtPrxQ01 306 3e-107 3..218 2..213
PbPrxQ01 305 4e-107 3..218 2..214
AdePrxQ 301 2e-105 1..214 2..210
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 804331..804540 210 N° 2 804092..804229 138 N° 3 803910..803999 90 N° 4 803594..803812 219
complement(join(803594..803812,803910..803999,804092..804229,804331..804540))


exon

Literature and cross-references SpolPrxQ01 ( Spipo20G0009000)
DNA ref. Phytozome 11:   pseudo20 (804540..803594)
Cluster/Prediction ref. Phytozome Gene 11:   31509692
Protein sequence: SpolPrxQ01 ( Spipo20G0009000)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   219
PWM (Da):   %s   23543.31  
PI (pH):   %s   10.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSTALPRHTLLLLHASSPKAPAAGRAQIPVLSRSSHSQIFGLRFSSAAGPSCSPPPAAAAARPVVSAKVSKGDVPPSFTLKNQDGKNVSLSTYKGKPLVLYFYPADETPGCTKEACAFRDSYEKFKKAGAEVIGISADDPSSHKAFAKKYRLPFTLLSDEGNRVRKDWGVPSDLFGTLPGRQTYVIDRKGVVQLVYNNQFQPEKHVDETLKLLQTL*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCTCCACCGCCCTTCCCCGCCACACCCTCCTCCTCCTCCACGCGTCGTCCCCTAAAGCCCCCGCCGCCGGCCGGGCCCAGATCCCCGTCCTCTCCAGGTCCTCCCACTCCCAG
ATCTTCGGGCTGAGGTTCTCCAGCGCCGCCGGCCCCTCCTGCTCCCCTCCGCCGGCCGCCGCCGCCGCCAGGCCCGTCGTCTCCGCCAAG
GTACTGCTCCGTCCTCCCCAAACCGGCGGC
CCTCTGCGCAATGCGCCACCACCAGCGGCTCTAATCCCTCTGTGAAACAAAACAAATCTCCGCCCCCCCAGGTTTCCAAAGGCGACGTGCCGCCGTCGTTCACCTTGAAGAACCAGGACG
GCAAGAACGTGAGCCTCTCCACCTACAAGGGGAAGCCGCTGGTGCTCTACTTCTACCCCGCCGACGAGACCCCCGGCTGCACCAAAGAG
GTAGGCTTGAAGATCTCCGCCATATCCCTTC
TGAAGGACTGACTGACCCATGACCCATGACCCATTCTCCGGCGACCCCTCCTCTTTCCCAGGCCTGCGCCTTCAGGGACTCCTACGAGAAGTTCAAGAAGGCCGGAGCGGAGGTGATAGG
GATCAGCGCCGACGACCCATCCTCCCACAAG
GTGCGCTCCCCTTCCCCCTTCCCCTTCCTCGTCGTCCTCTCCGATCGTCCCCCGGATTGACCTCTCGTCGCGTTCTGGCTTCCGCCATG
GATGGCAGGCCTTCGCGAAGAAGTACCGGCTGCCGTTCACCCTGCTGAGCGACGAGGGGAACCGGGTGAGGAAGGACTGGGGGGTCCCCTCGGACCTCTTCGGAACCCTCCCCGGCCGGC
AGACCTACGTCATCGACCGCAAGGGCGTGGTGCAGCTCGTCTACAACAACCAGTTCCAGCCGGAGAAGCACGTTGACGAGACTCTCAAGCTTCTCCAGACCCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCTCCACCGCCCTTCCCCGCCACACCCTCCTCCTCCTCCACGCGTCGTCCCCTAAAGCCCCCGCCGCCGGCCGGGCCCAGATCCCCGTCCTCTCCAGGTCCTCCCACTCCCAG
ATCTTCGGGCTGAGGTTCTCCAGCGCCGCCGGCCCCTCCTGCTCCCCTCCGCCGGCCGCCGCCGCCGCCAGGCCCGTCGTCTCCGCCAAG
GTTTCCAAAGGCGACGTGCCGCCGTCGTTC
ACCTTGAAGAACCAGGACGGCAAGAACGTGAGCCTCTCCACCTACAAGGGGAAGCCGCTGGTGCTCTACTTCTACCCCGCCGACGAGACCCCCGGCTGCACCAAAGAG
GCCTGCGCCTTC
AGGGACTCCTACGAGAAGTTCAAGAAGGCCGGAGCGGAGGTGATAGGGATCAGCGCCGACGACCCATCCTCCCACAAG
GCCTTCGCGAAGAAGTACCGGCTGCCGTTCACCCTGCTGAGC
GACGAGGGGAACCGGGTGAGGAAGGACTGGGGGGTCCCCTCGGACCTCTTCGGAACCCTCCCCGGCCGGCAGACCTACGTCATCGACCGCAAGGGCGTGGTGCAGCTCGTCTACAACAAC
CAGTTCCAGCCGGAGAAGCACGTTGACGAGACTCTCAAGCTTCTCCAGACCCTCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCT CCACCGCCCT TCCCCGCCAC ACCCTCCTCC TCCTCCACGC GTCGTCCCCT AAAGCCCCCG CCGCCGGCCG GGCCCAGATC CCCGTCCTCT CCAGGTCCTC CCACTCCCAG  ATCTTCGGGC TGAGGTTCTC CAGCGCCGCC GGCCCCTCCT GCTCCCCTCC GCCGGCCGCC GCCGCCGCCA GGCCCGTCGT CTCCGCCAAG GTTTCCAAAG GCGACGTGCC GCCGTCGTTC  ACCTTGAAGA ACCAGGACGG CAAGAACGTG AGCCTCTCCA CCTACAAGGG GAAGCCGCTG GTGCTCTACT TCTACCCCGC CGACGAGACC CCCGGCTGCA CCAAAGAGGC CTGCGCCTTC  AGGGACTCCT ACGAGAAGTT CAAGAAGGCC GGAGCGGAGG TGATAGGGAT CAGCGCCGAC GACCCATCCT CCCACAAGGC CTTCGCGAAG AAGTACCGGC TGCCGTTCAC CCTGCTGAGC  GACGAGGGGA ACCGGGTGAG GAAGGACTGG GGGGTCCCCT CGGACCTCTT CGGAACCCTC CCCGGCCGGC AGACCTACGT CATCGACCGC AAGGGCGTGG TGCAGCTCGT CTACAACAAC 
CAGTTCCAGC CGGAGAAGCA CGTTGACGAG ACTCTCAAGC TTCTCCAGAC CCTCTGA 

Retrieve as FASTA