Entry information : SpolGPx02 ( Spipo16G0036800)
Entry ID 13256
Creation 2015-06-19 (Christophe Dunand)
Last sequence changes 2016-02-23 (Catherine Mathe)
Sequence status partial
Reviewer Catherine Mathe
Last annotation changes 2016-02-25 (Catherine Mathe)
Peroxidase information: SpolGPx02 ( Spipo16G0036800)
Name (synonym) SpolGPx02 ( Spipo16G0036800)
Class Plant glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolGPx02
start..stop
S start..stop
SpolGPx01 87 8e-26 1..44 1..44
SpolGPx04 72 1e-18 1..43 1..43
BrGPx06-1Ab_other 70 1e-17 1..43 1..43
BnGPx06-1_other 70 1e-17 1..43 1..43
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2496957..2497010 54 N° 2 2498593..2498670 78  
join(2496957..2497010,2498593..2498670)


exon

Literature and cross-references SpolGPx02 ( Spipo16G0036800)
DNA ref. Phytozome 11:   pseudo6 (2496957..2503588)
Cluster/Prediction ref. Phytozome Gene 11:   31516439
Protein sequence: SpolGPx02 ( Spipo16G0036800)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   44
PWM (Da):   %s   4471.33  
PI (pH):   %s   10.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASASAQSPKSVHEFTVKDARGNDVNLGAYKGKALLIVNVASQW

Retrieve as FASTA  
Remarks Partial sequence from genomic. Only exons 1 and 2 are present due to N in the sequence. Incorrect prediction from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCATCAGCCCAGTCGCCCAAGTCGGTTCACGAATTCACCGTGAAGGTACCTAGAAGATGGGCTTTAGATGACCTTTAGCACGATTTTGGGTTTTACGGTCCCCTATTTCTT
CTCGATGGTTCTGGTGTTTAAGAATTTTTTGGAAGATTTGTTGCGGCTTGAGTTATCCGACATTTTTTTTGGCTAAAAGACAGATCCGTTCCGTGGTTGTTTTTTTGTCGTGGGAATCAG
GACGGTCAGGATGATTTTGCGGGTTTGAGGGATCTACCTGGCGATCATCATGATATGTTCTGGAGTTTGGCATAAAGAATTATATATCTGCAAGTTACTTTGGCATAAGCAGAGAGGACA
TGTGAGAATCGCTGAGATTAGATTGACTATATGTTGGCATCATGATGCATTCCAAGACTAGGATGAGAAATCTAAGGTTTGGAGGTGCAGCTTTTTCACCATATACGTGCTTGGGGTAAT
AGTATTTTAATAAATTCCTTGAGCTAATATATGCGATTATGAGTTTGACATCATTCCATCTTGTAGCTGCTAGATTTAAGGGATGATTGGTTGTTATATATATGCAAATATTGTTATGTA
CATAGGCATATATATGCATATGGACGTATATATGTACGTACATGCACATCTTAATGAATGTATATATGCAGAGTGTGCAGCATTGACTGCAATCCCTGTCTCAGATATACGGCCGCATTT
AATGCAGAAGAGGAGCTCTCCGTTCATGAGAGGGAGAATCAGTCCAATTGCAGACCTTATATGTCGACAGATGAAAACGACCCACTTATGAGCGGATAGAGGTGGACTAAAATGGCCTGA
CGACGGGATGAAGAGGAAATGGCCTAGCTGACTGTTTCTCACATAAATAACCCACGAGGGAAAAATTTCAGGGCACATTTTCAGTGGTCCATCAAAGGGTCCTAGGTCCTCCTAGGTGCC
GGTAAATTGAGGGCAAGATCTCTTGTTGGGTTAGGTGAGTACTTTGAGGGCCAAGTTCAGAGATCTATTATTATTTGGGTTCTTGGCGAGAGTTCTTTTGTGATTTTTTTTCTCATCTAA
TTGAACTTTAGTCATCAATCATGAACTTAGGAGGCCACTTTGGAACCACCTTAAATTTTTTGTGTTGGTGTTTTTGCTGTAAGTTGATCTTTCTCTTCTTTCCTACTTCATGTCGTACAG
ATCATAAGAGTTATTTTGTGATTTTTTCTCATCGAATTGAACTTTAGTCGTCACTCATGAACCAAAGGAGGCCGACTTTGGAAACACATTAAACTTTTTGTGTTGGTGTTTTTTCTGTGA
GTTGATCTTTCTCTTCTTTCCTACTTCATGTCGTACAGATCATAAGAGTATTATCCTGCAAGTTCATAACAGAATTTTTCTGTAACATGAAAGTGTGCCTTTTTTTATATATATTCTAAG
TTCATTTCAAGAAAAAACTTGTTTTTCTTTGATGTGTTTTGCATTTGGCTCTAAACTCTTTACTCCCAGAAAAAAATATTATGGAAATCGATGGAATCAATAACCTTGTTATTTTTTTCT
TCATTGTAAATTCTCTACACCAAGTCTAAATGGAAACCTCAGCACCTACAAAGGAAACTAATCAGCTCTCATACAGGACGCCAGGGGCAATGACGTCAACCTAGGGGCCTACAAAGGGAA
GGCACTTCTGATCGTTAATGTTGCATCACAATGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCATCAGCCCAGTCGCCCAAGTCGGTTCACGAATTCACCGTGAAGGACGCCAGGGGCAATGACGTCAACCTAGGGGCCTACAAAGGGAAGGCACTTCTGATCGTTAATGTT
GCATCACAATGG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTG CATCAGCCCA GTCGCCCAAG TCGGTTCACG AATTCACCGT GAAGGACGCC AGGGGCAATG ACGTCAACCT AGGGGCCTAC AAAGGGAAGG CACTTCTGAT CGTTAATGTT 
GCATCACAAT GG 

Retrieve as FASTA