Entry information : SpolGPx03 ( Spipo6G0008900)
Entry ID 13257
Creation 2015-06-19 (Christophe Dunand)
Last sequence changes 2015-06-19 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-03-07 (Catherine Mathe)
Peroxidase information: SpolGPx03 ( Spipo6G0008900)
Name (synonym) SpolGPx03 ( Spipo6G0008900)
Class Animal glutathione peroxidase    [Orthogroup: Gpx1002]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolGPx03
start..stop
S start..stop
AoGPx02 275 1e-96 1..174 1..171
ZmGPx02 270 2e-94 1..173 1..170
VvGPx05 269 3e-94 1..173 1..169
NtGPx05-1A 267 3e-93 1..174 1..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 716285..716350 66 N° 2 715687..715763 77 N° 3 715430..715491 62 N° 4 714616..714734 119
N° 5 712431..712598 168 N° 6 712247..712279 33  
complement(join(712247..712279,712431..712598,714616..714734,715430..715491,7156 87..715763,716285..716350))


exon

Literature and cross-references SpolGPx03 ( Spipo6G0008900)
DNA ref. Phytozome 11:   pseudo6 (716350..712247)
Cluster/Prediction ref. Phytozome Gene 11:   31506028
Protein sequence: SpolGPx03 ( Spipo6G0008900)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   175
PWM (Da):   %s   19427.01  
PI (pH):   %s   9.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGASQSSRAATKGNSIHEFSVKDNHGNEVSLGRYKGKVLLVVNVASKCGLTNTNYTQLTELYNKYKSDFEILAFPCNQFLNQEPGTSQQAESFACERFKAEYPIFQVRVNGPETAPVYKFLKASKTGLMGSRIKWNFTKFLVDKDGVVIRRYGPGTEPLSIEKDIQKALGEI*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGCGTCTCAGTCTTCCAGGGCAGCAACCAAGGGGAACTCCATCCATGAGTTCTCTGTCAAGGTAGGGCACGAGAAGTGCTTCTTCTTCTCCGTGTACTTGTTTTCCGTTTACTTT
TCTAGATCCGATCGTTCCAGGAGCAGGGTCGGAAACGTTTAAGTTGAAGTTTTGATCAGGGAAGTGAGAGCGAGAATCCAAAACACCAGGTGATGTTGCGGAGGGCTTGCCTTGCTTTCG
CTGATTTTCCCGAAGGAGTGGATGATGATGTGGTGTTGTTGTTGAGGAAGGGGTTGGAGGGGACGAGAGGAATGGTCTTGATCTCTTTCTTGTATATTTTTCTCTGTCGAAGATGGCAGG
GGGGGTCTTACACAAATATGGTCTAATTTCCATGGCAAGAATGGAGGGCAAAGAAAGAAAATAAGAAAGAAAGAAGGAAAGAATTTGTTTCATCTTGCACCGAAAGATACGGACGGTCTG
TTCTTGAAAATTTCCTATTAGCCCTATCGTGAGTGCCCTTTTTTAATACATCTTGTGACTCACGAAGTCTTTTTTGTTACTTATTGCCGCAAACTGCCAATCATCAGGATAACCATGGAA
ATGAGGTCAGTCTCGGGAGGTACAAAGGGAAGGTTCTCCTCGTCGTCAATGTTGCATCCAAATG
GTACAAATCAGTCATGCCTTTGATTGTCTTGAATTCTTCTCTTTAAACCTGTCTTC
TCTCCTTTTGAATTAATAATGTGACCTATTTTCTGTTTTTTTTTCTGATAGAGAGAAAACTGAAAAAATTACTTTTCCTCTGAAAGATGGTTTTTTTATTCTTCTTTCTTCTCTGCTTTT
TTTTTTGATGAACAAACAGCGGGCTTACAAACACCAACTACACCCAGTTGACAGAGCTTTATAACAAGTACAAGAGCAAAGGTTAGCTATGCCGATTTGCCTCTCTTTCTCTCCCTCCTT
GCTCTCCCCTCTTCATTCTTGGATTTTTATTTCTTTCAATTACTTGACAAATGACTTATCTTTATGCAACGTGCGTTGGCGTCACTAGAGTAAAATGTGCGTCGATTTTTGTTTGAAAAG
ACTCCTGTTCTACTTACGTTTCTTGAAGATTCTTGTGGAGAATGAATTATAGACATGATGGGTTTCTTCCCCATATTTTTGGATGGCTAAATCATTCAGCAGTTTATTCAGCTTCTTCTT
CAGACTAATATCTATCTTAATTTTTATGAAGATAAGTAATTATGTGCTGACATTTTCCATTTCAGAGATTGTGTTTTCTTCATTATAGAAGTTATTTATTGGTTTTCTCCAGAAGATAAT
CTATCCCTTGAAATATTTTCTATGAAAACAGATCAAATTTTACTTCTAAAATTGAACATTTTTACTTTTGAGTTTTTTGTCCTAATCTCTCACTCAATGTGGAGTACGTCGTTATTCTCT
TATATGTCTAACTTATGCCGCATGCAAAAAGTAGGATTTTACCAATCCTGTTTTCCCAAACGATTCCACACTGCTTGGGATTTAGTAATTTTTTTTTATTTTTAGCAAGGCATAATTTTG
ATGTACTCTTCTTTTCTTTTATCTTGATTTATTTTATCTCGTTGGGTGTGCAACAGACTTCGAAATTTTGGCCTTCCCATGTAACCAATTCCTGAATCAAGAACCTGGAACAAGCCAACA
GGCAGAAAGTTTTGCATGTGAGAGATTCAAAGCTGAGTATCCTATATTTCAAAAG
GTAAAGTTACTCCCCAGTTTCTTTCCCTTGTTTGATGGTGGTTGAAATGTATAACAACTTAGAAC
GACCTCATCAAAAGATTATTAAAGAAGAAATGTGATAATAGCGCGCATAATAGTATTTGCCTCTAGCATCCTCAAAATTCATTGCTTCCTTTGGTTTAGATGATGATATGCTGTTCTGTT
AATCAGTTTTCCAGACTATTAAGCACATTCTGCTTATGAAGTCCAACAACACAATGATCACATGAAGGCTTCCCTCTTATTTGATAATTTTATTCTGAATCTGTAGAACATTGTGATGCG
TCAATGTTCTGATTATTCTGCTTTGTGGATTGCAAGAAACGAAAACCGAAAAGTATATTTTGGATTTTTTTTTAAGCTCTTCCAGATGGAAACCCTACCTACTGTATTCTTATATTCCTA
GACTTGTTTGCCCCTTTGTTTCAGCCACTTTCCCTTTAATCGCATTTGCAAAAGATTGAACATGTTGACATGTGCGAACATGAGACTGCAGTAAAACATTCATTTTAGGTATGTCATTAA
TTTGAGCGGTTTCGTAATTTTAATAGTTCTGGCAATAAAATATTTTCCCTTCCTGCCATCTACTCTCCTGGGACTTCTAAGTGGACATTCTCTTATTGAAAGGTACCTAGGTTTTGCATG
AGAAAATTTTTGCTGGACAGAGAATTCTCCAAACAGTATTTCATAGGTTTTTGTTGCTTAGGAAGGCCTCATTTTTTAGAGTTGACCGTAGCACTGGGTCAAGCATTTGTTTATACCTGC
ATGAAACCCACTTAGTGATATATAATGAATTCATGAAAACCTCAATGATATATGTCGTTTCGTGCTGTGAATTTGGAGTTTAACAGGCCCCAAATTCCTGAATTTGCAGTTTTTTTTATA
TGTGCATGAAACCCACCTAGCTAATTCGCTGTTTCTTTCACTTTGACAGTCTTTTGGCATTAAGCCACTGATAGATATCTTGCTTCATCCCTCTTAATCATTGATATCTTCATTACTGCC
ATCGAGGGTTATCCTTTTCTTACTGCTTGAATAATTTGATATTTTTATCCTTTTCTGTATCTTTTTATGTCGTGAAATATATCCTTTGTCGATTGAAGTGGTTGGAAACAAAATATTTCT
ATTTTAAATAAAATTATTTAAGCTCTCTTCTTTTGGGGTCAAAATGGTGACAAGAAAAGATCATGGTTTTAATTGTTCTGAAGGCAGAAATGATTACTTTGTAACATGTTGTACAATATA
GCACGTGCACATCACCACTGCCAACTAGTGAACGAATAACGTAAAAATGACTGGAGGAGGAATATCATTGCACAATAAATGAAAAATATTTCCATGCGAGGCAGTGCGACCAGTTGATGC
TTCCTGCTCACCGCATCTGCCCTTCTTTTTTCTTCCTTTGTATATTTATTTGAAACAATCAAACAAACATAGTGAATTAGACACCGCGGCCAGAAGATAACATGAGAATTCTTCTTCAGC
TATTGATTAGCTCCCAAATTACTGTTATATTTGATTTTATTAGCCCTTCTTCGGTTCAAAAATACAAAATCAAACTTCAAAAAATGATTCCGTGGCCGTTTCCCTGTGTACAATAAACTC
CCTATTTGTCATGTGTGTATAGACAGAAACAAAGAAATGATGGGGAGGGATGGGGGGACGGGAAAGGTGAAGAAGCATAGAGTGGACAGTTTATCTAATTCATCTATTGTAGCATCTGGA
TTGCTACCTTTCTTGCACTTTATCCTTTGGTAACCCTTGAATAATCTTCTATTTTCTGCTTCACTCCATATGCATATGCAACAGAAAAAATTGTCTCACTCCCAAAGTTGTCTAGTTGTC
TGCATTTATTATTATATCTGAACTAAAAAGTTCTCTCATATATCGTGTTCATCTGCGGTGTCTATTTTTGCAATGCAACCGTATCAGATTTTGGGCAGGCTTTTCCACAAGGATGAGAAC
AAGAACTCTAGCTAGTTTTCCCTCTTTTACAGGTTCGAGTGAATGGTCCGGAAACAGCCCCGGTCTACAAATTTCTCAAAGCAAGCAAGACTGGCCTCATGGGATCTCGGATTAAGTGGA
ACTTCACCAAGTTCCTGGTTGACAAGGACGGCGTTGTCATCCGTCGTTATGGTCCAGGGACTGAACCCTTGTCCATAGAG
GTCAGAAGAAACACACCCTATTATAATTCTTATGTATGGG
TGAACTACCTAAACATTGGAGACGTCTGATTATTTAAAGTTATTTATTTCATTCTCTGAGTTGTTGTGGTTCTCTATCGCTCCATTAATGACCTTTTATTGTGAACTTCAGAAAGACATC
CAGAAGGCCCTGGGGGAGATCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGCGTCTCAGTCTTCCAGGGCAGCAACCAAGGGGAACTCCATCCATGAGTTCTCTGTCAAGGATAACCATGGAAATGAGGTCAGTCTCGGGAGGTACAAAGGGAAGGTTCTCCTC
GTCGTCAATGTTGCATCCAAATG
CGGGCTTACAAACACCAACTACACCCAGTTGACAGAGCTTTATAACAAGTACAAGAGCAAAGACTTCGAAATTTTGGCCTTCCCATGTAACCAATTC
CTGAATCAAGAACCTGGAACAAGCCAACAGGCAGAAAGTTTTGCATGTGAGAGATTCAAAGCTGAGTATCCTATATTTCAAAAG
GTTCGAGTGAATGGTCCGGAAACAGCCCCGGTCTAC
AAATTTCTCAAAGCAAGCAAGACTGGCCTCATGGGATCTCGGATTAAGTGGAACTTCACCAAGTTCCTGGTTGACAAGGACGGCGTTGTCATCCGTCGTTATGGTCCAGGGACTGAACCC
TTGTCCATAGAG
AAAGACATCCAGAAGGCCCTGGGGGAGATCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGCGT CTCAGTCTTC CAGGGCAGCA ACCAAGGGGA ACTCCATCCA TGAGTTCTCT GTCAAGGATA ACCATGGAAA TGAGGTCAGT CTCGGGAGGT ACAAAGGGAA GGTTCTCCTC  GTCGTCAATG TTGCATCCAA ATGCGGGCTT ACAAACACCA ACTACACCCA GTTGACAGAG CTTTATAACA AGTACAAGAG CAAAGACTTC GAAATTTTGG CCTTCCCATG TAACCAATTC  CTGAATCAAG AACCTGGAAC AAGCCAACAG GCAGAAAGTT TTGCATGTGA GAGATTCAAA GCTGAGTATC CTATATTTCA AAAGGTTCGA GTGAATGGTC CGGAAACAGC CCCGGTCTAC  AAATTTCTCA AAGCAAGCAA GACTGGCCTC ATGGGATCTC GGATTAAGTG GAACTTCACC AAGTTCCTGG TTGACAAGGA CGGCGTTGTC ATCCGTCGTT ATGGTCCAGG GACTGAACCC 
TTGTCCATAG AGAAAGACAT CCAGAAGGCC CTGGGGGAGA TCTAG 

Retrieve as FASTA