Entry information : SpolGPx04 (Spipo0G0143700)
Entry ID 13258
Creation 2015-06-19 (Christophe Dunand)
Last sequence changes 2015-06-19 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-03-07 (Catherine Mathe)
Peroxidase information: SpolGPx04 (Spipo0G0143700)
Name (synonym) SpolGPx04 (Spipo0G0143700)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolGPx04
start..stop
S start..stop
PtGPx06-1 269 3e-94 4..168 2..166
VvGPx06 269 4e-94 4..168 2..166
BnGPx06-1_other 266 5e-93 1..168 1..168
EgrGPx06 268 1e-92 2..168 82..248
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9584358..9584411 54 N° 2 9584841..9584917 77 N° 3 9585048..9585109 62 N° 4 9585316..9585434 119
N° 5 9585765..9585932 168 N° 6 9586025..9586057 33  
join(9584358..9584411,9584841..9584917,9585048..9585109,9585316..9585434,9585765 ..9585932,9586025..9586057)


exon

Literature and cross-references SpolGPx04 (Spipo0G0143700)
DNA ref. Phytozome 11:   pseudo0 (9584358..9586057)
Cluster/Prediction ref. Phytozome Gene 11:   31508669
Protein sequence: SpolGPx04 (Spipo0G0143700)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18753.51  
PI (pH):   %s   8.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAAPTSPRSVHDFSVKDARGNDVDLSIYKGKALLIINVASQCGLTHSNYTEMRQVYDKYKNGLEILAFPCNQFAAEEPGSNEQILEFACTRYKAEYPVFAIDVNGKNAAPLYKFLRSSKSGLSGGDIEWNFAKFLVNREGDVVGHFAPNTSPLNIEKDIKKVLGEP*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGCAGCCCCAACTTCTCCCCGGTCGGTTCACGACTTCTCCGTGAAGGTACGTCCGAGATAGGATCGAGAACGCGTTTGATGTGGTTTTTGGGTTCCGGACTTCACCGTCTTC
GTCGTTTGAACGTTCTTCGGAACCAGTGGGAGATCGATTTTTAAGGAGCGGTGATACTGGTTACTCTTGTAATCGGTGGCCCGTTCGTAGCTTGTTCGTTCATCATCGGCAACCGGGACG
CCTGAGGAAATTTTGGCATTCCCTTCAAATCGTTTCAGTTAAAGTAGATCTATCTCGTGTATTCAGGAGATTGCCACGGCTGGACGCTGTCGTGCGCAGCAGATTTCTTGAGTCTCTATG
AACCCTACAGACTTCAATCGAGCCGAACCCTAATTATTCGGTTCTATGAGTCTCTTCTTTTGAAATGCCCATCGACTACCAGTTTTTATGATGGGCTATACTGTTCTGTCGGCTTTAACA
CAGGATGCCAGGGGAAACGACGTCGATCTCAGCATCTACAAGGGGAAGGCACTGCTGATCATCAACGTCGCGTCACAATGGTATCATCGCTCTCTGCTCGCTCTGTTTGGAAAAAAAAAA
AAAGTGCGACCAAATTGGAGATTAACATTTCTATCTGATATCTTTTTAAGACGAGCCTCACGGATCTTTTCTTCCTTAAATCTGCTGCAGTGGATTGACCCACTCCAACTACACTGAAAT
GAGGCAGGTTTACGACAAGTACAAGAACAAAG
GTACTGTGGTCTTGACTCTGGCTGGTTCGGTCAACATCTATCCGTTACCAGTCACCGTCATTCCTCGCAAAGGACCATTATTGAGAGC
ATGTTCCCCACAAACTAGCAGTTTTTCACTTAAATTTGTCATTTTATGCCCTTACAAGCGATTTTTCTGTTTTTGATTCCTGGAACGACATCTGGAGCATATTTTATTTATCCGGCAGGT
CTTGAGATCCTGGCTTTCCCCTGCAATCAATTCGCGGCAGAAGAGCCGGGCTCCAACGAGCAGATACTGGAGTTTGCCTGCACTCGCTACAAGGCGGAGTACCCCGTATTCGCCAAG
GTG
ATCAGAAATACTGCCGCCTGGTTGTTCTTCAGCGTTGCCAAAATTGGGTTCATCTTCATTCGTTTCTGATTAAACATGTTGCGAGAGTGTACAATCTGGCTGTCTGTGGTCGTTCCAAAC
GTAGCCGGACTATCTGGGGTCCCTTGAGGAAAGTGGCGAGCTACAGATAGAAGCATCGCCATGTGGCTACTTTCTTCGATCCGATTCATTTGTGTGATCTCACCTCTGAGCAGAAGCTAT
TCTCATGATGACTTCTGTGATTTCATCTTCTACGATCTCGTCATGGTTGTCCCGTTGACCCTCATTTTATTCTCCTGCCGGGACTAGATCGACGTGAATGGGAAAAACGCGGCTCCCCTC
TACAAGTTCTTGAGGTCGAGCAAATCCGGGCTCTCAGGAGGTGATATCGAGTGGAACTTCGCCAAGTTCTTGGTCAACAGAGAAGGGGACGTGGTGGGTCACTTCGCCCCTAACACCTCC
CCTCTCAACATTGAG
GTAAAGGAACTCTCTCTCTCTCTCTCTCTCTCACCCACACACACACACCAATCCTGCGATTTGTTGAACTGTTTTTGAATGGTTTATCGCAGAAGGACATAAAGA
AGGTGTTGGGCGAGCCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGCAGCCCCAACTTCTCCCCGGTCGGTTCACGACTTCTCCGTGAAGGATGCCAGGGGAAACGACGTCGATCTCAGCATCTACAAGGGGAAGGCACTGCTGATCATCAACGTC
GCGTCACAATG
TGGATTGACCCACTCCAACTACACTGAAATGAGGCAGGTTTACGACAAGTACAAGAACAAAGGTCTTGAGATCCTGGCTTTCCCCTGCAATCAATTCGCGGCAGAAGAG
CCGGGCTCCAACGAGCAGATACTGGAGTTTGCCTGCACTCGCTACAAGGCGGAGTACCCCGTATTCGCCAAG
ATCGACGTGAATGGGAAAAACGCGGCTCCCCTCTACAAGTTCTTGAGG
TCGAGCAAATCCGGGCTCTCAGGAGGTGATATCGAGTGGAACTTCGCCAAGTTCTTGGTCAACAGAGAAGGGGACGTGGTGGGTCACTTCGCCCCTAACACCTCCCCTCTCAACATTGAG
AAGGACATAAAGAAGGTGTTGGGCGAGCCGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCG CAGCCCCAAC TTCTCCCCGG TCGGTTCACG ACTTCTCCGT GAAGGATGCC AGGGGAAACG ACGTCGATCT CAGCATCTAC AAGGGGAAGG CACTGCTGAT CATCAACGTC  GCGTCACAAT GTGGATTGAC CCACTCCAAC TACACTGAAA TGAGGCAGGT TTACGACAAG TACAAGAACA AAGGTCTTGA GATCCTGGCT TTCCCCTGCA ATCAATTCGC GGCAGAAGAG  CCGGGCTCCA ACGAGCAGAT ACTGGAGTTT GCCTGCACTC GCTACAAGGC GGAGTACCCC GTATTCGCCA AGATCGACGT GAATGGGAAA AACGCGGCTC CCCTCTACAA GTTCTTGAGG  TCGAGCAAAT CCGGGCTCTC AGGAGGTGAT ATCGAGTGGA ACTTCGCCAA GTTCTTGGTC AACAGAGAAG GGGACGTGGT GGGTCACTTC GCCCCTAACA CCTCCCCTCT CAACATTGAG 
AAGGACATAA AGAAGGTGTT GGGCGAGCCG TGA 

Retrieve as FASTA