Entry information : Pau2CysPrx01 ( VrPrx)
Entry ID 13288
Creation 2015-07-02 (Qiang Li)
Last sequence changes 2016-02-04 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-04 (Christophe Dunand)
Peroxidase information: Pau2CysPrx01 ( VrPrx)
Name (synonym) Pau2CysPrx01 ( VrPrx)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Vigna
Organism Phaseolus aureus (Mung bean) (Vigna radiata)    [TaxId: 157791 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pau2CysPrx01
start..stop
S start..stop
Pv2CysPrx01-2 458 7e-166 1..261 1..260
Pv2CysPrx01-1 457 2e-165 1..261 1..260
Ps2CysPrx 435 1e-156 1..261 1..263
Mt2CysPrx02 432 1e-155 14..261 15..265
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 151..342 192 N° 2 939..1013 75 N° 3 1087..1168 82 N° 4 1246..1325 80
N° 5 2023..2148 126 N° 6 2333..2446 114 N° 7 2586..2702 117  
join(151..342,939..1013,1087..1168,1246..1325,2023..2148,2333..2446,2586..2702)


exon

Literature and cross-references Pau2CysPrx01 ( VrPrx)
Literature Kang,Y.J et al., Genome sequence of mungbean and insights into evolution within Vigna species. Nat Commun 5, 5443 (2014)
Protein ref. GenBank:   ACZ56426.1 UniProtKB:   D5FUD7
DNA ref. GenBank:   NC_028353.1
mRNA ref. GenBank:   FJ857948.1
Protein sequence: Pau2CysPrx01 ( VrPrx)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   261
PWM (Da):   %s   28462.65  
PI (pH):   %s   5.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSAPSASLISSNPNILFSPKFPSSSSFSSLSFPNSSNSIFKPLRTSLNPSSPALKPLVARASSELPLVGNTAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFEELNTEILGVSVDSFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSYGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETKRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTCCGCTCCTTCTGCTTCTCTCATCTCCTCAAACCCTAACATTCTCTTCTCTCCCAAATTCCCTTCTTCTTCTTCCTTTTCTTCCCTCTCCTTCCCCAATTCCTCCAATTCC
ATTTTCAAACCTTTACGCACTTCTCTTAATCCCTCATCTCCCGCTCTCAAACCCCTCGTTGCCAGGGCTTCG
GTACTTCTTTTCGCCTTCCACTTACTCTCCTCCCCCCCACAAATTCTT
ACATTGCGCTGCAATAATTTCCTCATTTTTTTATCTTTCTGTTGATTTTACTGTTACCTGCTTGTTTTGTTGTTGCCATTTATTTTTTTTTGCATTTTTCTTGTTGGCATTTTTCATTTT
CAACTCTCTAGTTTGGGGTCCTAGCTAGTTTCGCTCACCTTCGAATTTTATACACCTTTGTGACTGAACTGTGTAGTCGGTGATTTTGAAGGTTATGTTTCTGCATCTGCATTTCTGATC
ATATTAGTTCATAGATATGTTACATGTAGTCCAGTGTACACAAATTCAGTGTAATTCGTAATTACTCGAACAATGTTTTAGAATAATATGGTAATTCTACACTCTTCCTCCTTCGAGGTT
GTGAGTTTTGTACTGGAATTTGTGTTCGTGTGTGGGATAATCTTTTTCTGCAAACCATGACAGCTAACCATGACAGCTGTAACTTCCTTGATGAAGCTGAAAACTCAAAGTTTTTTAGTG
TGTAACATTTCTCTGGTCTGACGTTTGGAGCAATTTATTTATCCTTTTTTCTTTGCTTATTTTGAAAGAGTGAACTTCCATTAGTTGGGAACACAGCACCGGATTTTGAAGCAGAGGCTG
TTTTTGATCAAGAGTTCATCAAG
GTATTTATGATACAATGCTGATTGGTAAATTTTGTGATTACAAATTATGTTGAATAAAACACTGTCTTGTCAGGTCAAACTATCTGAATATATTGGG
AAAAAATATGTTATCCTCTTTTTCTACCCATTGGATTTCACATTCGTTTGCCCGACAG
GTTAGTAGACTTCCGATTGAGATTGTTGTGGATCCTGTGTTTTCTTCTGTTTTAACTGTAAT
ATTACCTGTGTACAGAAATCACCGCCTTCAGTGACCGGCATGCAGAGTTTGAGGAACTAAACACAGAGATTTTGGGTGTTTCAGTTGACAGTGTGGTGAGTTTGTTTAGACCCCTTTTTT
AACTATTTCGTCAGATTCTAGCTGTTGTATAATTGTTTCCCGTACTTTTTCCAAGGCATTGTCTGATCCATGTAACTGACGGTACCAATTGGGGAAAAAAACTTTGTTGTTATACTTTTC
TCAATTCTTGAAATGACTTGCTTCTTGGCTCTATACAAGCTGTTGAGGAAATGAAAGGTGTGCGATGACATGGCCCACTTGCCACATAGTTCAAGGTTGTAATGATTTATCAGTCAGGAA
GAAGCTATGATATGACTGAGTTGTTAGCATAGCTGGCAAAATTGTATGAATTCTGCATTTTTATTTTCTACGAAACTTAGTGCAAAGAATTAGGACGTGTAGGAGAAAACTGTAGGAGGA
AATTACTTCATAGATAATGAAAAGTCAAATCTTGGACAATGAGTCATTCGAACCATGATAATTAAAATGTATTTTTCTTTACCTACAGATGTAATGTTATTCTCAATATTTGTGAAGGAT
GTGTGACATTGTGGAGTGGGACACAATATTCCCACTTGTTCACGAGGCATGCCCAAGAAAACAGACAGCTTTTATATGCTGTGATCTATTACTATTCCTTTTTTAAATGCACAATTATCT
TTTTGTAGCCTTATCTATAGGCACTTCTTAAGTTTGCTTCTTCTTGATTAGTGATGCTGTTTATCATTGCAGTTTTCACACCTTGCATGGGTTCAAACTGATAGAAAGTCGGGTGGTCTT
GGCGACTTGAAGTATCCTTTGATTTCTGATGTCACCAAATCCATCTCGAAATCTTATGGTGTTCTCATTCCCGATCAG
GTATTTTTAAATGATGGATCTTCATCTTACCTGAATGTATTG
TGTGCTCTAGTTTCAAATTGGATGCTGTCTACCTTTAGCTTTTTATGTCAAGTGTTGAAATGTTGGCTGTGAAACTATTGCTTTTTTCATTAAACCTTTTTAGCACTTTTCACAACAATT
CTAATTTTTTCCAATGATTTAGGGGATTGCATTGAGAGGATTGTTCATTATTGACAAGGAAGGGGTTATTCAGCATTCTACCATTAACAACCTGGCCATTGGTAGAAGTGTTGATGAGAC
AAAGAGAACACTCCAG
GTAATTATTTATACGACAAATCAGGACAAGACCAGGATTGACAATATTTTAGTGTATCTCCAACTTTTTATTTGTTTGTTCCACACATCTGTCATTTATATAAA
GTCTTTGCATCCATTTATTTGCATTGGTCTTGCAGGCCTTGCAGTATGTGCAGGAGAACCCAGATGAAGTTTGCCCAGCTGGGTGGAAGCCTGGTGAGAAGTCCATGAAACCAGACCCTA
AACTTAGCAAAGAGTACTTCTCTGCTATTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTCCGCTCCTTCTGCTTCTCTCATCTCCTCAAACCCTAACATTCTCTTCTCTCCCAAATTCCCTTCTTCTTCTTCCTTTTCTTCCCTCTCCTTCCCCAATTCCTCCAATTCC
ATTTTCAAACCTTTACGCACTTCTCTTAATCCCTCATCTCCCGCTCTCAAACCCCTCGTTGCCAGGGCTTCG
AGTGAACTTCCATTAGTTGGGAACACAGCACCGGATTTTGAAGCAGAG
GCTGTTTTTGATCAAGAGTTCATCAAG
GTCAAACTATCTGAATATATTGGGAAAAAATATGTTATCCTCTTTTTCTACCCATTGGATTTCACATTCGTTTGCCCGACAGAAATCACCGCC
TTCAGTGACCGGCATGCAGAGTTTGAGGAACTAAACACAGAGATTTTGGGTGTTTCAGTTGACAGTGTG
TTTTCACACCTTGCATGGGTTCAAACTGATAGAAAGTCGGGTGGTCTTGGC
GACTTGAAGTATCCTTTGATTTCTGATGTCACCAAATCCATCTCGAAATCTTATGGTGTTCTCATTCCCGATCAG
GGGATTGCATTGAGAGGATTGTTCATTATTGACAAGGAAGGGGTT
ATTCAGCATTCTACCATTAACAACCTGGCCATTGGTAGAAGTGTTGATGAGACAAAGAGAACACTCCAG
GCCTTGCAGTATGTGCAGGAGAACCCAGATGAAGTTTGCCCAGCTGGGTGG
AAGCCTGGTGAGAAGTCCATGAAACCAGACCCTAAACTTAGCAAAGAGTACTTCTCTGCTATTTAG

Retrieve as FASTA