Entry information : GtAPx03
Entry ID 13353
Creation 2015-08-04 (Christophe Dunand)
Last sequence changes 2015-08-04 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-10 (Catherine Mathe)
Peroxidase information: GtAPx03
Name GtAPx03
Class Ascorbate peroxidase     [Orthogroup: APx002]*
Taxonomy Eukaryota Cryptophyta Geminigeraceae Guillardia
Organism Guillardia theta    [TaxId: 55529 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GtAPx03
start..stop
S start..stop
SsAPx04_AU1 276 1e-91 12..286 94..353
RobtAPx04 273 3e-91 12..285 16..274
CbrebAPx07 271 1e-90 13..285 17..274
SmAPx03-2_72 270 4e-90 12..285 86..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1053096..1053217 122 N° 2 1053568..1053706 139 N° 3 1053761..1053811 51 N° 4 1053857..1053946 90
N° 5 1054012..1054095 84 N° 6 1054263..1054394 132 N° 7 1054446..1054493 48 N° 8 1054664..1054717 54
N° 9 1054766..1054810 45 N° 10 1054861..1054965 105  
join(1053096..1053217,1053568..1053706,1053761..1053811,1053857..1053946,1054012 ..1054095,1054263..1054394,1054446..1054493,1054664..1054717,1054766..1054810,10 54861..1054965)


exon

Literature and cross-references GtAPx03
DNA ref. JGI genome:   scaffold_10 (1053096..1054965)
Cluster/Prediction ref. JGI gene:   65752
Protein sequence: GtAPx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   290
PWM (Da):   %s   31724.45  
PI (pH):   %s   4.61
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQKDGSDSRDGRELMEKESCAPLMLRLAWHDAATYRADGGKSDDSDKSTGEWPRCGGVNGSITFAPELDLPCNKGLTLALSLLYELEKNDLVSVADVIQMAGQVAVEFSGGPKIAMRWGRSTTGVKYLCSDSDRGNPPFASSLSAPEHLRQIFGLMGLSDQEIVVLMGAHTLGRARPSRSGEGAAATCYTRDGPGRCKGGSSWTQEWLKFDNSYFKNLLLTPPADSQLLRLSTDSALAEDPVFREWVEKYAEDQELFFSDYARTHRKMSELGAKFEPQEGIEVDLEEG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGAAGGACGGCAGCGACTCACGGGATGGCAGGGAGCTCATGGAGAAGGAGAGCTGTGCTCCCCTGATGCTGCGGTTGGCATGGCATGACGCGGCAACTTATCGAGCAGATGGAGGA
AA
GTGGAGGACGAGGAAATGATGACGACGATGATGATAATGATGCCAATGAGGCCGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGA
TGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGGTAATGATGGTGATGGTGATGG
TGATGGTGATGGTGATGGTGATGGTGATCGTGATCGTGATGGTGTTTAAGATGCTGTTGATGTTGATGTTGACGTTAGCAATAATATTGAAGATAGTGCGGTGGCGGATGAGATCGGATG
ACTCTGACAAGTCTACAGGGGAATGGCCGAGGTGCGGAGGCGTCAACGGCTCCATCACCTTCGCTCCCGAACTCGATCTCCCCTGCAACAAGGGACTGACACTCGCACTCTCACTCCTCT
ACGAGCTTCAA
GTGCGTCGGGGGAGACGGAGATGTCGATGAAGGGACTTACAGCCTTTCCGACAGGAGAAGAACGACTTGGTCTCTGTTGCCGACGTCATCCAGATGGCTGGACAAGTAA
CTCCCTGCTCTTTCTGTGCTCCTACTCATCCTCCCTCTCAGGTGGCAGTTGAGTTCTCGGGCGGTCCCAAGATCGCGATGCGATGGGGGAGGTCAACAACAGGAGTGAAATATCTGTGCT
CTGACTCTGAC
GTGGCAGGAAGCATGTGGACGACCCGGACTGTTGTGCAGACCCTGCTGTCTCTCAAGACCTAGAGCGAGGAAATCCTCCCTTCGCTTCCTCTTTGTCTGCTCCTGAGCA
TCTGCGGCAAATTTTCGGTCTAATGGGCCTGTCTGACCAG
GTCTGCCTACCATGTCTTCCCGTACCTCCATCTGCTCCAGCTAGTTTTCAATCTTTGCATCCTCTATCCACCTATCTGCT
CCTGCCACTTCCTCTGCTCTTTCCCTGTCTTGTTCTGCTTCTCACTCTCGCTTCTCCTCTCCCTCTCCTTCTTTTCTTTTGCACCAGGAGATCGTCGTCTTGATGGGTGCTCACACGCTG
GGGAGGGCGCGGCCATCACGGTCAGGGGAAGGGGCGGCAGCGACTTGCTACACGAGAGATGGGCCAGGGAGGTGCAAGGGAGGGTCGAGCTGGACTCAG
GTGAGGCTGAGCTGGGCTTGC
CGAGCTGTCAAAGTCTCATGTCAACCTCAGGAGTGGCTCAAGTTTGACAACAGCTACTTCAAGAACCTCCTGCTGACGGTAGGCATGACCAGCAGCCCCTCCACTTGATTCGCAGCATTT
TCTGCATCATTCTCCAGCCCTCCTAGCCTCTCCCCCCTTCCACTAACTGCATATTTCCTGCTCTGCTCTCCTGCTCTTCATTGCTCGAATCTAATCTTCTGTTGTTGTCTCTCACGATTC
TCCTGCAGCCACCAGCTGATTCTCAGCTCCTTCGCCTCTCGACCGATTCAGCACTCGCAGAGGTTTCCAGCCTCCGTCTCTAGGGCAACTCTCCAGCTGAACCCGTGCAGGACCCGGTGT
TTCGAGAGTGGGTGGAGAAGTACGCGGAGGACCAG
GTAGGCTCTTGTGCAGCTCGCGTAGCAGCTGGGGTTGACCTGGGCCCCAGGAGCTGTTCTTCTCGGACTATGCGCGAACTCACCG
CAAGATGAGCGAGCTGGGGGCGAAGTTCGAGCCTCAGGAAGGGATTGAGGTAGACTTGGAGGAAGGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGAAGGACGGCAGCGACTCACGGGATGGCAGGGAGCTCATGGAGAAGGAGAGCTGTGCTCCCCTGATGCTGCGGTTGGCATGGCATGACGCGGCAACTTATCGAGCAGATGGAGGA
AA
ATCGGATGACTCTGACAAGTCTACAGGGGAATGGCCGAGGTGCGGAGGCGTCAACGGCTCCATCACCTTCGCTCCCGAACTCGATCTCCCCTGCAACAAGGGACTGACACTCGCACTC
TCACTCCTCTACGAGCTTCAA
GAGAAGAACGACTTGGTCTCTGTTGCCGACGTCATCCAGATGGCTGGACAAGTGGCAGTTGAGTTCTCGGGCGGTCCCAAGATCGCGATGCGATGGGGG
AGGTCAACAACAGGAGTGAAATATCTGTGCTCTGACTCTGAC
CGAGGAAATCCTCCCTTCGCTTCCTCTTTGTCTGCTCCTGAGCATCTGCGGCAAATTTTCGGTCTAATGGGCCTGTCT
GACCAG
GAGATCGTCGTCTTGATGGGTGCTCACACGCTGGGGAGGGCGCGGCCATCACGGTCAGGGGAAGGGGCGGCAGCGACTTGCTACACGAGAGATGGGCCAGGGAGGTGCAAGGGA
GGGTCGAGCTGGACTCAG
GAGTGGCTCAAGTTTGACAACAGCTACTTCAAGAACCTCCTGCTGACGCCACCAGCTGATTCTCAGCTCCTTCGCCTCTCGACCGATTCAGCACTCGCAGAG
GACCCGGTGTTTCGAGAGTGGGTGGAGAAGTACGCGGAGGACCAGGAGCTGTTCTTCTCGGACTATGCGCGAACTCACCGCAAGATGAGCGAGCTGGGGGCGAAGTTCGAGCCTCAGGAA
GGGATTGAGGTAGACTTGGAGGAAGGCTGA

Retrieve as FASTA