Entry information : EsilAPx01 ( Esi_0055_0060)
Entry ID 13374
Creation 2014-11-19 (Bruno Savelli)
Last sequence changes 2016-02-10 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-10 (Christophe Dunand)
Peroxidase information: EsilAPx01 ( Esi_0055_0060)
Name (synonym) EsilAPx01 ( Esi_0055_0060)
Class Ascorbate peroxidase    [Orthogroup: APx002]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EsilAPx01
start..stop
S start..stop
EsilAPx03 460 4e-166 17..291 1..276
EsilAPx02 451 1e-160 3..291 90..378
GtAPx02 340 4e-117 9..291 70..364
PtrAPx01 320 5e-110 3..284 35..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..15 15 N° 2 340..436 97 N° 3 686..722 37 N° 4 1484..1653 170
N° 5 2342..2460 119 N° 6 3347..3439 93 N° 7 3753..3886 134 N° 8 4469..4616 148
N° 9 5753..5815 63  
join(1..15,340..436,686..722,1484..1653,2342..2460,3347..3439,3753..3886,4469..4 616,5753..5815)


exon

Literature and cross-references EsilAPx01 ( Esi_0055_0060)
Literature Cock,J.M. et al., The Ectocarpus genome and the independent evolution of multicellularity in brown algae. Nature 465 (7298), 617-621 (2010)
Protein ref. GenBank:   CBJ27103.1 [Mismatch] UniProtKB:   D7G488 [Mismatch]
DNA ref. GenBank:   FN648763.1 (409361..403878)
EST ref. GenBank:   FP292104.1 [5' end]   FP292583.1 [3' end]
Protein sequence: EsilAPx01 ( Esi_0055_0060)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   291
PWM (Da):   %s   30852.05  
PI (pH):   %s   5.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADAKVAALQACKAEVMDLCAAHHCNPILVRLAWHDAGTFNKDSAEPWPRCGGANGSIRFEPEINHGANAGLVNALQLLQPIKDKHPEVGWADLIQLASAAAIEQGGPVIDMKYGRKDATTPQCCVDEGSLPAGNAPFPDADTPAHLRNVFYRMGFGDEGIVALSGAHTLGRAKKDRSGEGAECTKFTAEGVCPRGAGAPGCGKPGGSAWTPNWLKFDNSYFATVPDEGCDSELLKLATDKCLFVDEGFLPLAQKYKASQEAFFEDYKAHKMLAELGAVWEPEGGITI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns) and 11 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGACGCAAAGGTGAGAAGGGGTGCGGAGACCGAGGGGAGTTGTGTGTTGGGGCGAAAGAGCTTCCTGCCGCGAAGGAAAAAGAACACCACAGCCCGATTATTGTTTATGTTGTGA
GCAGGTTGCATTCTGACGGGCTTTGCCATCTTTTGTTCTGTCCCCGGATCATTATTAAGTGTTAAACCGCGGTTTCTGTGTATTCCGTTGCTTTATGTGTGTTTCGGAGGATCGGCCCTG
CGCACGCTCACATGCTCTCTGATCACACACGATTTTTTTTTTGTCCGTGCTTTTTCTTGGCGGGATCGGTCGTGGCGGTATGCATGGGCGCGCCCGCAGGTAGCTGCTCTTCAGGCGTGC
AAGGCCGAGGTAATGGACCTTTGCGCGGCTCACCACTGCAACCCCATCCTGGTCCGCCTAGCATGGCACGACGCTG
GTAACACCATGTACCTAGTTTAGGATGCATGTCGACGTCCGTTG
CGTTAGCCAACAACGGTTCCGGAAGAGTGCATGTGTAACCCTGACCCTCAGAAGGAGAACCCTTTTTGCGCACCTGAAATGACCGGTGTTGAGTGAGTTTATTTGTCGCTTCAACTTCTC
TGCATCGCTCCTGCTAACCCACGCATCCGACCGTTACAAGAAACGTGCCTAACTATGTAGTGGGACGTTTTCACCCCTCCCTCAGGCACTTTCAACAAGGACAGCGCGGAGCCGTGGCCG
AG
GTACGAGCGCAACGCGTGGGACATATTTTTTCTGACGCCTCAAGAGTAGTGTCACGAGATTATGTGGACTGAAAATCGCGCAGGGTTCCTGTGTGTCTGTGTGTGTGTGTGTGATGTT
CTGAGTTTTTTTCTACTGTAGCATCGACCTCGCTAACCGGCTGACTATTGAAAGACCTCAGTATGTTAGTTCATGTGTTTTGTGCGTTGGGTCCTCCTCGGCCGCGAATGGCGCCTGACC
GGTGAACGAAAGGCGGCAGCGTGAGCAAAAAAAATAAGTGCAAGCTCGCTTGTCTTGGTCTATGATTTGTATGGACGCGTGTAGCTTCGCGGGCATGCACCCGATGCGTGTGATGAGATC
GATAGCGGGATGAGGGAAGCGTGAAATTAAAAAACTGCCCCTTGGGCGAGCAGGTGCAAGGCGGTGTTCTTCGTCCTTCCATTTATTTCTCGCTTCCGAGGTCTGTGTGCTGACTCCTCG
CTATTTGTTGTCCAATCTCTGGTCTATTCACAGCCGTACGACCCATTATTGTTCCAATCTCTCTCTTGTCTTACTTGCTGATTTCCAGCACTCGCCGCACCAGCGCTCAGGCAGACACGC
ACGGACATGCCAATATCGCGCCCTCTCGTTCTCTTCCCGGGCCGGCGTCCCGTGTGATTCTGGAAACAAACAGCATCCGATCAGATCCACGCCCACCCTTAACCCTACGGTACACATACC
CTCTGCCTTGCGTTCGGTGGCACCGGGCGGGGAACCAAAATAGGTGCGGCGGGGCTAACGGGTCCATCCGCTTTGAGCCGGAGATCAACCACGGTGCCAATGCCGGCCTCGTGAACGCCC
TCCAGCTGCTGCAGCCAATCAAGGACAAGCACCCGGAGGTTGGGTGGGCGGACCTGATCCAGCTTGCCTCTGCCGCGGCCATCGAGCAGGCTG
GTCAGTTTTTTTTTTTTTTCGCTAACG
GGTCTGCTGGCGGGGAGCGGAAAGAGGCCCTTGGTTCATTCGTGTTGCGCTAAGCCTAAACCTAGCGGGGTTGTTTGTGGCGGTAATGAGCACTAACACGGTTGTCGTTGGCGGCAGTGG
GTGATGATGATGACAGCGTGCAGAGTGACTCCCTGGTGCGTGCGCGCCATCATCAGAGACCAGAGGAGTAGTGTGTGCGGTGATGGCGTGATGCGATAGATGCGTTGTCGAGATCTGCTG
TCGACAAGACCACCATATGAGACGAATCACGGTATGCATAGGTGAACACGAGTTGGAGTGTTGGTACAAACGCTGGATTGTGTGTCGGTCTGATCTGTAGCCAAGCGAGTTGCGGGGCAA
GTGCTTCGGTATGACATGCACAGGGTAGCCGGGTGGGTCGCTATCAACAAGTGACACGTGGATATTCAACATCAACAATGTTTGCATCTTGTTCTTCGAAAGGTATGTGTACGTTTCCTT
CCCTGCAACTGCTGAAACCACTTTTACTTCCCGTATAAGCACCGTGGAAGTGTGCCCTGTCTGTGCATTACTTCTACAAGATATGGTGAACTTAGCGCTTTGGGTATTTTCTTGCCACGA
AATCAGCATGGCATGCACGTAAACTTTATTCTACATGTACAACACAACACAACCTATGCAGGTGGCCCCGTGATCGACATGAAGTACGGCCGGAAGGACGCCACGACGCCGCAGTGCTGC
GTGGACGAGGGCTCCCTCCCCGCGGGAAACGCGCCCTTCCCCGACGCCGACACGCCTCAG
GTTTGGATACAGAGTTCCGCAACGTTTTTATTTTGCAGGCTGATGTATAGCAAGTAAAGG
AAGTCCTCAGGGAGAGGAATCATTCTGTGTGACCACGGGTTGGAGCCCTTACCGGGCAGAACTGATGTAGCAAGCGCTGAATAATAGTGATGCAATAAAAAATGAAGTAACGTGCTGCTG
AGACAAAAAGGAAAAGCGATGGTTGATGATAACGTTGCATGAGTTGGCGTGCTGCTGTCCTCAGCACGTCGCTCTCAAAGCTTCCGGTTGATCTCGCTGGCCGGTGGGACGATTCGAACA
CTCTGAATCTGAATCTTCATGTTCTTTGTTGAAAGATCGTCTAGAACGTGTACCCTCCCCCCCCCCCCCCGCCCCCTCCAGGGTGCCCTCTCTGTTTTGCACACAAGGCAGTTACGAGGA
AGCGGTTGCTGTTTTTTGTGGGGATGGCTGTGGTGCACGAGGTGGTTTAGGGAGGTGCCGGCGTGTGGAGAACATATTTAGTGGTACTCTGCTGAACCCATAGCGATTTTAACGTGGACG
GTTGACTTTCTGCGGATGTGCATGGCCGATTTGGTTGTGCTGCTTGAGTAGACAACACATAGCACACACACTGAGACGGCCTTTTAAGTGTCTCAAACCGGAGGAGGGTAGAGCTGCGTC
TCTAGACGGGCTTGTGGTGAACGGTCCAGCCACAAAGGCAACCAATAATGAATATCCTCCTCCTAAACTCTTAACAGCGCGTGTTTCTCTTCCTCTCCCTATGCCTGGCATTGCTCTGTG
AGCGTCTGCTACTCTTGCTGCTATTCCATCAAGGTTGGCTTATTGCTGTGAGTGAGTTTCCCCTACCCGCTTGTCGTCGTTTGACCTACTTTTTTCCTGTGCGCAGGCCCACCTCCGGAA
CGTGTTCTATCGCATGGGCTTCGGTGACGAGGGCATCGTGGCGCTCTCCGGCGCCCACACCCTCGGAAGGGCCAAAAAG
GTAAGTATTGGTGCTCATGCTTGCTGCTTTTTTCAACGACT
ACATGATCGTATTCGACGTGCTGCTGCTGCTGCATGTTTAACTGTCTGCATGCCACTGGTTGCTCCGCGGGTTGGACCATCGTTGTATGTTGTTGTGTTTTTTTGTGTGATGTCCCTGCG
GGTTGACAGCCAGCAAGTACTAGAAGCGCCGCGGATGGTGGTAGTTACCAAGACGGCAGAGTGGATGTCCGAATTCTGAAATTTCGAGACCCGGTACTAAACGCTCACCCGCTTAAAAAC
TCGGCCCGTCACTTTTTCTTTTTTTTTTCCAGGACCGCAGCGGTGAGGGAGCCGAGTGCACCAAGTTCACCGCGGAAGGCGTGTGCCCCAGAGGGGCGGGTGCCCCCGGCTGCGGAAAGC
CCGGAGGGAGCGCCTGGACACCGAACTGGCTCAAGTTCGACAACAG
GTGTGTGTGTGTATCCGCTGTTGTGTTTTGTTTTGAGTCTGCGACGCTGACCGCTGAGGTACGTCGTCAAACGT
TGTCGGTGCTCGTTTGCTTGCTTGGTTGGGGCGGGGGGCGTACTCATGCTTTTCGTGCCATAGGGGCGGCGGGGGGGAGGGGGGGTGAGCTGCCGGCGAACTTGTCGATGGGATCGATCA
TTGTGCACGGACGAGCCTGTCAGGTAGGTGCATGTTGAGACCTGGCGGGGAAGCTGGCGTCGGGTTCCCGTGTTGTTAGCTGCAGGTTTCAGTTACTGTCGACGATGCATATTCTGGCGT
CATCTCACGTTGATCAAATTACATAGTAGTGTGTTTCCGTGCTTTCGCCGTTGTATGTTCATTTACGGCTAACGTGCGATGGCGTTTTTCACTTGTTCCAGCGTATCGTTCGCATCGGTG
GCTCGTTTACGCCACGTCCTTTAGCCACAGAAACACGAATAGGCACAACATTCACATGTACAGCGGTTGCGGTTACGCCTTTCGATGTAGTGTTGGTGCGGTCTCTAAAAAATCGATTCT
TGTGCGCTCCCTCCCCTTGGTGCCGCAGCTACTTCGCGACTGTGCCGGACGAAGGGTGCGACTCTGAGCTGCTCAAGCTGGCGACCGACAAGTGCCTCTTCGTCGACGAGGGCTTCCTCC
CCTTGGCCCAGAAGTACAAGGCCAGCCAGGAGGCGTTCTTCGAGGACTACAAGAAG
GTATGCGTGCGTGCCTACACTGCTGAACCGTCGGTGTTTCTTTTTTTTTGTGCGTTGATTTTTT
GGGGGGTTTTCGTCCGGTCTGTTCTGCGCCAGGGTACAGAAGGCCTTACACGAAGACTGTGCGTACGAGAAGGTATACAGGGCCAGTGCCAGCCCCTTCGCTGGCCAAGACTATCTAGTC
AGTGCGGGGAGGGGGTCGATTGGCTGATACATGGAGGTCCAGCCGTGTTGCTACCTGAACTTTTTTTCGTCAAGTCCGGGTGGAATCTGTGATTTTGTGTTCTCAGTTTGATTTGGTGTT
GATGTTCCTGTACTGCCGTTTTAACACACCTGAAGGGTGTCAGGGATGAGTGGCCTGAATAACGGGAAAAACCAGACTCACGCCCCGACTGGTAGGACGGTGGCAGCACAGCGTTGTTTG
TGGTAGTTCTTTGTTGGTGCAGCGGTACAACGGCTGTACTCCTTTGCATTCCTTGGTGTTGATCCCGCGTCCTGGCATGAGGGATAAGACCTGCTGTTTCGATTGGACCTTTGGTACCTT
ACGCTGCTTGCCGTTCGCCTTTTTGGATAATTTTTCCCCGGAATATTTTGTGTTGAAAGTAGTTGAAAGTTTTCTCGACCTTTCAATTGTTTCAGACTTTCCGTGGGGAACTTGTGGGCA
CACTAATAGTGCAGCCTCGAATGATGCGGACAGAGGAGATTCTGGATAGAATAATATTTTTTACGCGTATACCGACCCGACGGTGTGTGTCGCGCACGGACTCCTTTTTACCTCGGCCGT
CTGGGTCGCGTTGTCGTGGCCGTTCTCAAGTCTACACAAGAGCTAGTTCCGGAGTTTTTTTCCGGAGTGTGCTAATACTGTGTACCGTACTCACGACGTTAACGGTGGTCGAACGTGGTA
GGTTGGACCGGGTGCCACCCACCACCATCGTGGGGGTAACGACTCAGCGGCGGACTTTGCCAATATTACAGTATTTCCTGCGAGATGATCTACGTGGCCCGTTGGCATGAAATGTAAGGT
CGCCAGGACGCAATGCTCTTGTTGTGTCAGCCGAGATGCCCCCCTCCCCTGTCATCGCCTCAGCGACTTGCCTTCACCTCCGATGTATTGTTGCCCAATCTCAATGTTACAGGCTCACAA
GATGCTCGCAGAGCTCGGCGCTGTTTGGGAGCCTGAAGGCGGCATTACTATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGACGCAAAGGTAGCTGCTCTTCAGGCGTGCAAGGCCGAGGTAATGGACCTTTGCGCGGCTCACCACTGCAACCCCATCCTGGTCCGCCTAGCATGGCACGACGCTGGCACTTTC
AACAAGGACAGCGCGGAGCCGTGGCCGAG
GTGCGGCGGGGCTAACGGGTCCATCCGCTTTGAGCCGGAGATCAACCACGGTGCCAATGCCGGCCTCGTGAACGCCCTCCAGCTGCTGCAG
CCAATCAAGGACAAGCACCCGGAGGTTGGGTGGGCGGACCTGATCCAGCTTGCCTCTGCCGCGGCCATCGAGCAGGCTG
GTGGCCCCGTGATCGACATGAAGTACGGCCGGAAGGACGCC
ACGACGCCGCAGTGCTGCGTGGACGAGGGCTCCCTCCCCGCGGGAAACGCGCCCTTCCCCGACGCCGACACGCCTCAG
GCCCACCTCCGGAACGTGTTCTATCGCATGGGCTTCGGTGAC
GAGGGCATCGTGGCGCTCTCCGGCGCCCACACCCTCGGAAGGGCCAAAAAG
GACCGCAGCGGTGAGGGAGCCGAGTGCACCAAGTTCACCGCGGAAGGCGTGTGCCCCAGAGGGGCGGGT
GCCCCCGGCTGCGGAAAGCCCGGAGGGAGCGCCTGGACACCGAACTGGCTCAAGTTCGACAACAG
CTACTTCGCGACTGTGCCGGACGAAGGGTGCGACTCTGAGCTGCTCAAGCTGGCG
ACCGACAAGTGCCTCTTCGTCGACGAGGGCTTCCTCCCCTTGGCCCAGAAGTACAAGGCCAGCCAGGAGGCGTTCTTCGAGGACTACAAGAAG
GCTCACAAGATGCTCGCAGAGCTCGGC
GCTGTTTGGGAGCCTGAAGGCGGCATTACTATCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGGCGTCAC GCGATCGATC CCCTTACATC TCCTCTTCTA TTAACAGCCA GGTGCCCGCC TTGGAGGAAT ATTGCTGTCC CCTCATCTAC AATCGACTTG AGAATATAAC ACCATGGCTG  ACGCAAAGGT AGCTGCTCTT CAGGCGTGCA AGGCCGAGGT AATGGACCTT TGCGCGGCTC ACCACTGCAA CCCCATCCTG GTCCGCCTAG CATGGCACGA CGCTGGCACT TTCAACAAGG  ACAGCGCGGA GCCGTGGCCG AGGTGCGGCG GGGCTAACGG GTCCATCCGC TTTGAGCCGG AGATCAACCA CGGTGCCAAT GCCGGCCTCG TGAACGCCCT CCAGCTGCTG CAGCCAATCA  AGGACAAGCA CCCGGAGGTT GGGTGGGCGG ACCTGATCCA GCTTGCCTCT GCCGCGGCCA TCGAGCAGGC TGGTGGCCCC GTGATCGACA TGAAGTACGG CCGGAAGGAC GCCACGACGC  CGCAGTGCTG CGTGGACGAG GGCTCCCTCC CCGCGGGAAA CGCGCCCTTC CCCGACGCCG ACACGCCTCA GGCCCACCTC CGGAACGTGT TCTATCGCAT GGGCTTCGGT GACGAGGGCA  TCGTGGCGCT CTCCGGCGCC CACACCCTCG GAAGGGCCAA AAAGGACCGC AGCGGTGAGG GAGCCGAGTG CACCAAGTTC ACCGCGGAAG GCGTGTGCCC CAGAGGGGCG GGTGCCCCCG  GCTGCGGAAA GCCCGGAGGG AGCGCCTGGA CACCGAACTG GCTCAAGTTC GACAACAGCT ACTTCGCGAC TGTGCCGGAC GAAGGGTGCG ACTCTGAGCT GCTCAAGCTG GCGACCGACA  AGTGCCTCTT CGTCGACGAG GGCTTCCTCC CCTTGGCCCA GAAGTACAAG GCCAGCCAGG AGGCGTTCTT CGAGGACTAC AAGAAGGCTC ACAAGATGCT CGCAGAGCTC GGCGCTGTTT  GGGAGCCTGA AGGCGGCATT ACTATCTAAG AAGTTTCGCC TCCTGAAACG GTTCTTGGAA TGGTGGCCGC ATTGCTCGAG CTCCGCGGTG CCGCTTTTGT CAGCTCGGGT CGCTCTCGCC  AACGGTCGAA TGTAACATGA CCGTTACTGC GATGGCGCCA CCGATGGTTG TAGATGGCGC GCACCCCAGG GATATTTTGA TATGTTTTTT CTTGCTCTTT TATCACAACG AATCCATCAC 
AACGAATCCA TCTCTATCCA CAGACATGAG TCCGGGATAA ATTTGTAATG AAATCATAGC GTTTATTTCG GAAAATCCGC CGATCGGCAT CTTCTTCAAA 

Retrieve as FASTA