Entry information : EsilAPx03 ( Esi_0359_0023)
Entry ID 13392
Creation 2014-11-19 (Bruno Savelli)
Last sequence changes 2015-08-05 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-10 (Achraf Jemmat)
Peroxidase information: EsilAPx03 ( Esi_0359_0023)
Name (synonym) EsilAPx03 ( Esi_0359_0023)
Class Ascorbate peroxidase    [Orthogroup: APx002]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EsilAPx03
start..stop
S start..stop
EsilAPx01 460 4e-166 1..276 17..291
EsilAPx02 389 1e-136 3..276 106..378
GtAPx02 297 1e-100 10..276 87..364
UfAPx01 286 1e-97 2..269 16..278
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 118492..118555 64 N° 2 119136..119172 37 N° 3 119389..119558 170 N° 4 119992..120110 119
N° 5 120630..120725 96 N° 6 121127..121260 134 N° 7 121858..122005 148 N° 8 123029..123091 63
join(118492..118555,119136..119172,119389..119558,119992..120110,120630..120725, 121127..121260,121858..122005,123029..123091)


exon

Literature and cross-references EsilAPx03 ( Esi_0359_0023)
Literature Cock,J.M. et al.,The Ectocarpus genome and the independent evolution of multicellularity in brown algae. Nature 465 (7298), 617-621 (2010)
Protein ref. GenBank:   CBJ32725.1 [Incorrect splicing] UniProtKB:   D7FZA8 [Incorrect splicing]
DNA ref. GenBank:   FN648552.1 (118492..123091)
Protein sequence: EsilAPx03 ( Esi_0359_0023)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   276
PWM (Da):   %s   29795.39  
PI (pH):   %s   4.62
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMCAADDDNPILIRLAWHDAGTFNKDSAEPWPRCGGANGSIRFEPEINHEANLGLVFGLKLLQPLKDKYPEVGWADLIQLASATAVEEGGPVIDMRYGRKDAATPKDCVDEGNLPAGDAPFPDADTPAHLRNVFYRMGFGDEGIVALSGAHTLGRAGQLNAEGDWSPCTKFTAAGVCPRGGDAPSKGNPGGSSWTRNWMKFDNSYFATVPDGEGGSELFKLETDKCLFVDKGFLPFAQKYKESQEAFFEDYKAHKMLSELGAVWEPEGGFAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). Incorrect prediction from NCBI (extra exon). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGTGCGCGGCCGACGACGACAACCCCATCCTGATCCGGCTCGCGTGGCACGACGCCGGTAAGATCGAGACAAGGAGGACAAAACATGCTTGGCTCGACTAGGCAGAGAGTTGC
TGAAGGCTGCAACGACTGGTACAACAGCCCTAGTTCGTTTGTAGGTCGACGATAACTCCGTGCTTTGCGGAGCCTCTGTATCCTCCATGAGCTATTTTGTGCGCTGGTAATGAGGTACCC
GAAACCCCTGCGAGATGGAGCGAGAGGCTGTTGTGCTCGTGAGCAAAAAGGCGGATGTCAAAAAGACGCCTCAAAAGCCGGCTGCTCTTGCAATAGCTCTTCATTGTAGATCCCACTTTT
TCGCCAAGCGCCAAGCATCGACTCGGTGATGTATGTGCCACTTGCTGCGACGCTGTACGTACTCCGCCTGTATTGCATGCATGCATTCAGAGCGACCTGAACTTGAGAACTTGGGTTATT
ATAATGTTACCCGACTCGTGTTGCGTGATGTGACAGCACCGCACGATTTGCTCCCCCTTTCCCATTCCCCGCGTCCGGGTGCCTCCTCTACAATCCGTGAACTTGACCTCTCACCGACCG
TGGGAATTCCTCGGCGGAAACCTGATGTTTGCTGGGGACTCCAGGAACGTTCAACAAGGACAGCGCGGAGCCGTGGCCGAGGTACGTCGCGACCCTCCCTGCCTTGTATTCAACCCCCCT
CGTGCTGACCCTGCTTGGGGTGCATCCCACCCGATACGCATTCCCTCGAAGGTGCTTTTGGCCGATTACTCTAATTTTGCGTTGTATTTTTTCGTTCTTCCTCTATTGGCTTCTGCCTTG
TGTTCTTCTTGCTGCTGTTGCTGCCTACTGCTTCCCCTTGTCTCTTCTGCCCTTTAGGTGCGGCGGCGCGAACGGCAGCATCAGGTTCGAGCCCGAGATCAACCACGAAGCCAACCTTGG
CCTGGTGTTCGGCCTGAAGCTTCTGCAGCCCCTCAAGGACAAATACCCGGAGGTGGGCTGGGCGGACCTCATCCAGCTCGCGTCGGCGACGGCGGTTGAGGAGGCCG
GTGAGGGAGAGTC
TAAATCTCAAGCTGATTGTTACAAATGTAGGATACGAGGGAGCAGGGCCGTGGCTCTGGCTAATGGAACGGCTATCGTGCAGGGCATGTGCCCAGTGAATTTTAACGACGTACCGGGTTA
GGAATGTCAAGGGCACTGTCTGTGTGCAGGCAGGAGCCTTCCTCCAGCCCTTGACGGGACAGAGTTCTGATGTAGTTTGCTAGTTCATAAGGCACGAGCACGGGGCTCGGCGTTGTCACA
GTGATGGCTGCCAGAAGGTCGGATGAGACGAAGCTGGATTGATAGGCTGGGGAAGGATAGGGCTAGGGGATCTCTGTCGAGAAGAGAAAATGGGGACTGGTATCCCTGGTACACGATATG
CCACAGCAAATACTGTGGAGCCCTTCCGTTTTACCCGATTTCGTCTTCTTAAAACGTCAGGCGGACCTGTGATCGACATGAGGTACGGGCGAAAGGATGCCGCGACGCCGAAGGACTGTG
TAGACGAGGGCAACCTCCCCGCAGGGGACGCTCCTTTCCCTGACGCGGACACGCCGCAG
GTTGGTTGGAACGGCGCGTTGATGTGTTGATGTTTGCTGCGTCCGTGTGCATTTTTCTTGT
GTGCCCTAACACGCAATGCATCCCGAGAATGCCCGGCACGGGTTCTTTCGTAGCCTGAGTTGGATGCTTCTACTTCCGGTCGACACCATGGAGACGGTGTGTTGAAGTTGCTCCTGGCAG
GTCTGCTCTTCAGCAAGTCATGTCCCGATGATGTTATTTGGGTTTGTTGTGGCTGTGTTGTATCCCCCTTGCTTTCGTGTCGTTGGCGTCTATCAAAGGACTTGAATAGAAACATACCTG
TTTTCCTCTTGAAGCGCCCGCGCTGGCACTAGGAAAAAACTTTCCAGCCTGGCTGACGCCATTGCTCGCGCCAGAGGTTGGAGACATGTGCTTGGTATGGATGTAGCTTCTTTCAGTCGT
TGTGCCAGCTCTGCCTCAAAACTCGGTAGATGTGGGCGACACCGGCGGATTCGGTCTCAGTTTCTCACGCGAAGAACGCTTTTTGTTTGTTCGTCCAGGCGCACCTCCGGAACGTGTTCT
ACCGGATGGGCTTCGGCGATGAGGGCATCGTTGCTCTGTCCGGCGCCCACACCCTCGGGCGGGCCGGCCAGCTG
GTACGCACAAACCCGAACACAGACATAGACACGTATGTTTTTGTAC
CTCGGCAGTCAACAGCACATATGATTATGTATCGTGTCTGGTCATGTCGTGTCGCACATACTCAAACTCGGTGAGTCTACCCCTCGCGTAACGTCCACCCTCACATGCCACAGGCAGCTT
ATATCGGTGTTCACCTTTCCTTAGCTGCCATTCGTCGGCTACAGACTACCGGTTTCTGTGGAGATGCGCGTGTCCCGAAGGATTCTCGTTTGTCTTGGAGCGAGGCTACAGCGCTGTCTC
ATCTCCGGGCTCACGCCGAATCAATTGATGTATGCATTACTTCTTGTGTGCCTTGTGTTTCTGTCGACGGGTGGATGCGTCTTGGTTGGTGTGTCCTTCTGTGTATCACCCGCAGAACGC
CGAAGGCGACTGGTCGCCGTGCACCAAGTTCACGGCCGCCGGCGTATGCCCCAGGGGGGGCGACGCACCAAGTAAGGGAAACCCCGGGGGAAGCTCCTGGACACGGAACTGGATGAAGTT
CGACAACAG
GTGAGCCCTGCGTGTGTGTGTGGCTTTGTCGGTAGCATCGACCAATAAAGATTCGTCAGCCTTTTCCGGGCAAGGAGACGTAGCAGCCATCTCACGTTTCGGGGCACCTTG
GTGAGGGCTCCTCAAAAGCAGGTCGACTTGGTTTGGTGTGCGTGTGGTGAAGATCGCCGAGATGGAGTTGTGAGCGTACTTGCGAGGCGGAACATTGCTTTGAAGAACCCTGATCGTTGC
ATGCTCACGCTTTAGTTCTTAAAGCTGTCTATCGCGGTGGAAGCTACCACACTTTTGCTTTCGGTTACCGCCCGTGGCCATGTATTTGTGTGCTTGGAAGCGGTCGTGGGTGCGTAGTTA
CCCCATCGACGCCTTGACCAGTTGCTGGACAATGCCGATTTCTTCTTGTCCTGCGGCTCCTCTACACTCTTGAGCGTCCACACACTCTTGAATTTCGGTTGACGGCGCCTGCGTCCACAA
CCATACCGACGTTCGCAACATGTGGCTCGCGGGTCGTTTTGCGTTCTTTGGGTTTCTTGTCAGCATCCCCCCCCCCCCCCAAAATCACGTTTCATGGGCGTGCGTTGTGCCCGCCGACTT
CTCCAGCTACTTCGCGACCGTGCCGGATGGAGAGGGCGGCTCGGAGCTATTCAAGCTGGAAACCGACAAATGCCTGTTCGTGGACAAGGGCTTCCTGCCCTTCGCGCAGAAGTACAAGGA
GAGCCAGGAGGCCTTCTTCGAGGACTACAAGAAG
GTCGGTGCTGGCGTTTCGCCTTTGAAGTTGTCTTTGTCTCTGGTGGTGATGATGGTGATGTCGTGTGTCGCACACTTGTTTAGATG
CTATTTAGGTTCAGCGAAACGCGGGGTTCTGTTTTGCGAGGCGAACCGCGGGGGGGGCGGTTATCCAGCACTATCAGGTTTATCTCTAGTGCGGTTTAACGCGATCCATTGAGAAGGCCA
CTTTCCCACGTTTCAGAGCCAATTCGGTTTCATGAACACGTGACCCGACCCGGGAGAAGTGCGTCCAATAGCCGCGTGTCCCATGTGTGACATGTTGCGACACGGGTCGTTTTCCCGTAT
TTTTCTTTCGGGCAGAATTGAACCGCGATGTTTCCACAGGTATGATAGGATAGGTCAGATCACAATCGATCGATCTACATACATATTGTACATCATTTTCGTCGCAGATCACCAAAATCT
AAAGGTACAGATCGATGTGTCAATGTTTTCGATTCTTGATCTATTGACATAGATATTGATCTATTGACATTGATATGCATAGATCTGAACATGCCTGCCGCGCTTGATGAATAATCCATA
GATCATCTTGGATATTTCCGATTCTTGATCTATGGACACAGCTAGATCCGGACGTGTTTGCCGCTCTTGATCTATAATCCATAGATCATCTGTGATATTTCCAACTCTCAATCTGCAGAC
ACCATATAGGTCCGAACATGTTTGCCGCTCTTGATCTATCATCCATGGATCATCTGTGATATCCGACTCTTGATCTATGGGCACAGATCATGTATGATGCTCCCGACGCTTAATCAATAA
GACCGCAGATCATCAAGATCATGATCTATCCTATGTGTGGATGTTTCGTGCCTCTGCAAGTCACTCCTAAAACGGTCATAACGGATCCGGATCTTCAAGCATCTGCGTTGTGGCACAGCA
CCATCTTGTAGCGGTTCAGTCGCCCGTGAAAGTATTACACTGTATCTGCAACAACGAACGAATGCTCCCGAACTCTGCCTCCGTTTTCCATCTCCAGGCCCACAAGATGTTGTCGGAGCT
CGGTGCCGTGTGGGAGCCAGAGGGCGGCTTCGCCATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGTGCGCGGCCGACGACGACAACCCCATCCTGATCCGGCTCGCGTGGCACGACGCCGGAACGTTCAACAAGGACAGCGCGGAGCCGTGGCCGAGGTGCGGCGGCGCGAACGGC
AGCATCAGGTTCGAGCCCGAGATCAACCACGAAGCCAACCTTGGCCTGGTGTTCGGCCTGAAGCTTCTGCAGCCCCTCAAGGACAAATACCCGGAGGTGGGCTGGGCGGACCTCATCCAG
CTCGCGTCGGCGACGGCGGTTGAGGAGGCCG
GCGGACCTGTGATCGACATGAGGTACGGGCGAAAGGATGCCGCGACGCCGAAGGACTGTGTAGACGAGGGCAACCTCCCCGCAGGGGAC
GCTCCTTTCCCTGACGCGGACACGCCGCAG
GCGCACCTCCGGAACGTGTTCTACCGGATGGGCTTCGGCGATGAGGGCATCGTTGCTCTGTCCGGCGCCCACACCCTCGGGCGGGCCGGC
CAGCTG
AACGCCGAAGGCGACTGGTCGCCGTGCACCAAGTTCACGGCCGCCGGCGTATGCCCCAGGGGGGGCGACGCACCAAGTAAGGGAAACCCCGGGGGAAGCTCCTGGACACGGAAC
TGGATGAAGTTCGACAACAG
CTACTTCGCGACCGTGCCGGATGGAGAGGGCGGCTCGGAGCTATTCAAGCTGGAAACCGACAAATGCCTGTTCGTGGACAAGGGCTTCCTGCCCTTCGCG
CAGAAGTACAAGGAGAGCCAGGAGGCCTTCTTCGAGGACTACAAGAAG
GCCCACAAGATGTTGTCGGAGCTCGGTGCCGTGTGGGAGCCAGAGGGCGGCTTCGCCATCTAA

Retrieve as FASTA