Entry information : CcriCcP01 ( CHC_T00010263001)
Entry ID 13408
Creation 2014-11-19 (Bruno Savelli)
Last sequence changes 2015-08-10 (Christophe Dunand)
Sequence status partial
Reviewer Achraf Jemmat
Last annotation changes 2016-02-11 (Achraf Jemmat)
Peroxidase information: CcriCcP01 ( CHC_T00010263001)
Name (synonym) CcriCcP01 ( CHC_T00010263001)
Class Cytochrome C peroxidase     [Orthogroup: CcP004]*
Taxonomy Eukaryota Florideophyceae Gigartinaceae Chondrus
Organism Chondrus crispus    [TaxId: 2769 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcriCcP01
start..stop
S start..stop
CcriCcP01_1kP 473 5e-170 115..365 10..260
GfuCcP01 455 6e-163 116..365 8..257
BgeCcP01 435 9e-155 117..365 20..268
GfiCcP01 431 4e-153 117..365 12..260
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..582 582 N° 2 687..1047 361 N° 3 1140..1345 206  
join(1..582,687..1047,1140..1345)


exon

Literature and cross-references CcriCcP01 ( CHC_T00010263001)
Literature Collen,J. et al., Genome structure and metabolic features in the red seaweed Chondrus crispus shed light on evolution of the Archaeplastida. Proc. Natl. Acad. Sci. U.S.A. 110 (13), 5247-5252 (2013)
Protein ref. GenBank:   XP_005710845.1 UniProtKB:   R7QSS1
DNA ref. GenBank:   NW_005178624.1 (7136..5792)
mRNA ref. GenBank:   XM_005710788.1
Cluster/Prediction ref. JGI gene:   17318562
Protein sequence: CcriCcP01 ( CHC_T00010263001)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   382
PWM (Da):   %s   37511.85  
PI (pH):   %s   6.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MISSTSPAHDPPPLTTLPHNLALPPSPPAPRPSRHRIPPPSLDQPHHGLPPPFPHRTPARAPHGPASAPVASGVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDAINELLDVDDDLGPTLVRLAWHASGTYDKISDTGGSDGATMRFPPESAYDANAGLGVARAALDPIKKRFPGITYADLWTLAGAVAIEHMGGPQILWRPGRRDSRDGKAAPPDGRLPDGDKGKVGATIRHVRDIFVRQGFNDREMVALIGAHAIGRCHTDRSGYTGPWTRAPTTFSNLFFKELTENTWTLKQWDGPDQFEDPTGDLMMLPADMALLWDREFRKYVMEFAKDEDKFFEEFAKAFQKLEENGVRAFRGPGAAGKTWYQLW

Retrieve as FASTA  
Remarks Partial sequence from genomic (2 introns). Undetermined residues due to N in the sequence.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCTCATCGACATCGCCCGCCCACGATCCGCCGCCGCTCACAACCTTGCCTCACAACCTTGCCCTTCCCCCATCGCCACCCGCGCCGCGTCCCTCCCGCCACCGCATCCCCCCCCCC
TCCCTCGATCAACCTCACCATGGCCTCCCGCCTCCTTTCCCGCACCGTACTCCTGCACGCGCGCCGCACGGCCCCGCGTCTGCGCCCGTCGCTAGCGGCGTCCATNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGGACGCCATCAACGAGCTG
CTGGACGTCGACGACGACCTCGGCCCCACCCTCGTCCGTCTCGCGTGGCACGCCAGCGGCACGTACGACAAGATCTCTGATACCGGCGGCAGCGACGGCGCCACCATGCGATTCCCCCCC
GAGAGCGCCTACGACGCTAACGCAGGCCTCGGCGTCGCCAGGGCCGCGCTCGATCCCATCAAGAAACGCTTCCCCGGCATTACGTACGCCGACTTGTGGACG
GTACGTTGAAAACGCCCC
CCTTTCTTTTGTCTTTTTGCTTTCGGGGAGGCCCGCTTTCGCTGTGGACCATGCCCCGGTGGCTGACGCGCGTTTGTGTGATGTAGCTTGCGGGCGCCGTAGCGATCGAGCACATGGGCG
GGCCGCAGATCTTGTGGCGGCCCGGGCGTCGCGACTCACGCGACGGCAAAGCGGCACCGCCGGACGGGCGCCTGCCGGACGGCGATAAGGGCAAGGTCGGGGCGACCATCCGCCACGTGC
GCGATATTTTTGTCCGGCAAGGATTCAATGACAGGGAGATGGTCGCGCTCATCGGCGCCCACGCCATCGGGAGATGCCACACCGATCGCAGCGGGTACACAGGGCCCTGGACTAGGGCTC
CGACTACCTTCTCCAACTTGTTCTTCAAGGAGCTCACTGAGAATACTTGGACGTTGAAGCAGTGGGATGGACCGGACCAGTTTGAAG
GTAAGGTTTTGCTTGGGGCGATCTTGGGGACGT
GTGGAGGCGATGGTAGAGGCTAACATTTTTATGGTTGTTTTGTGTGCTTTGTGATGCAGATCCGACTGGCGATCTCATGATGCTGCCAGCTGATATGGCGCTTCTGTGGGATAGGGAATT
CCGCAAGTATGTAATGGAGTTCGCAAAGGACGAGGACAAGTTCTTCGAGGAATTTGCCAAGGCCTTCCAGAAGCTCGAGGAGAATGGTGTCAGGGCGTTTCGGGGCCCGGGCGCCGCAGG
GAAGACATGGTATCAACTCTGGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCTCATCGACATCGCCCGCCCACGATCCGCCGCCGCTCACAACCTTGCCTCACAACCTTGCCCTTCCCCCATCGCCACCCGCGCCGCGTCCCTCCCGCCACCGCATCCCCCCCCCC
TCCCTCGATCAACCTCACCATGGCCTCCCGCCTCCTTTCCCGCACCGTACTCCTGCACGCGCGCCGCACGGCCCCGCGTCTGCGCCCGTCGCTAGCGGCGTCCATNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGGACGCCATCAACGAGCTG
CTGGACGTCGACGACGACCTCGGCCCCACCCTCGTCCGTCTCGCGTGGCACGCCAGCGGCACGTACGACAAGATCTCTGATACCGGCGGCAGCGACGGCGCCACCATGCGATTCCCCCCC
GAGAGCGCCTACGACGCTAACGCAGGCCTCGGCGTCGCCAGGGCCGCGCTCGATCCCATCAAGAAACGCTTCCCCGGCATTACGTACGCCGACTTGTGGACG
CTTGCGGGCGCCGTAGCG
ATCGAGCACATGGGCGGGCCGCAGATCTTGTGGCGGCCCGGGCGTCGCGACTCACGCGACGGCAAAGCGGCACCGCCGGACGGGCGCCTGCCGGACGGCGATAAGGGCAAGGTCGGGGCG
ACCATCCGCCACGTGCGCGATATTTTTGTCCGGCAAGGATTCAATGACAGGGAGATGGTCGCGCTCATCGGCGCCCACGCCATCGGGAGATGCCACACCGATCGCAGCGGGTACACAGGG
CCCTGGACTAGGGCTCCGACTACCTTCTCCAACTTGTTCTTCAAGGAGCTCACTGAGAATACTTGGACGTTGAAGCAGTGGGATGGACCGGACCAGTTTGAAG
ATCCGACTGGCGATCTC
ATGATGCTGCCAGCTGATATGGCGCTTCTGTGGGATAGGGAATTCCGCAAGTATGTAATGGAGTTCGCAAAGGACGAGGACAAGTTCTTCGAGGAATTTGCCAAGGCCTTCCAGAAGCTC
GAGGAGAATGGTGTCAGGGCGTTTCGGGGCCCGGGCGCCGCAGGGAAGACATGGTATCAACTCTGGTAG

Retrieve as FASTA