Entry information : PviPrx03(Pavir.5KG773800)
Entry ID 13466
Creation 2015-10-06 (Achraf Jemmat)
Last sequence changes 2015-10-06 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2019-10-09 (Christophe Dunand)
Peroxidase information: PviPrx03(Pavir.5KG773800)
Name PviPrx03(Pavir.5KG773800)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Panicum
Organism Panicum virgatum    [TaxId: 38727 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PviPrx03
start..stop
S start..stop
SiPrx07 565 0 20..343 27..347
SbPrx69 565 0 30..350 35..355
ZmPrx139 537 0 20..343 28..346
OsPrx23 521 0 30..343 34..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..441 441 N° 2 517..1131 615  
join(1..441,517..1131)


exon

Literature and cross-references PviPrx03(Pavir.5KG773800)
Cluster/Prediction ref. Phytozome Gene 12:   30195529
Protein sequence: PviPrx03(Pavir.5KG773800)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352 (325)
PWM (Da):   %s   37186.04 (34755.8)  
PI (pH):   %s   8.71 (8.95) Peptide Signal:   %s   cut: 27 range:27-351
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGPCSASLAAAVAAGLLLISGGCVVAQQPPPVAQGLSFDFYKRSCPKAESIVRSFVQDAVRRDVGLAAGLLRLHFHDCFVQGCDASVLLDGSATGPGEKQAPPNLTLRPSAFKAINDIHTRLQRECAAAVVSCSDVLALAARDSVVASGGPSYRVPLGRRDSTSFATQQDVLGGLPPPTATAPALLAVLSKLNLDAADLVALSGGHTIGLGHCTSFEGRLFPRQDPTLNATFAGLLRRTCPAMGTDRRTALDVRTPNKFDNKYYVNLVNREGLFTSDQDLFSNAATRDMVARFAQSQKAFFDQFASSMVKMGQIKVLTGKQGQIRSNCSARNNPAGLLLPWSISILDDQAF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCCTTGTTCTGCTTCGCTCGCTGCCGCAGTGGCGGCCGGCCTCCTCCTCATCTCCGGCGGCTGCGTCGTCGCCCAGCAGCCGCCGCCGGTGGCGCAAGGCCTGTCGTTCGACTTC
TACAAGCGGAGCTGCCCCAAGGCGGAGTCCATCGTGCGGAGCTTCGTGCAGGACGCGGTGCGCCGGGACGTGGGCCTCGCCGCGGGCCTCCTGCGCCTCCACTTCCACGACTGCTTCGTC
CAGGGCTGCGACGCCTCCGTCCTGCTCGACGGCTCCGCCACCGGCCCCGGCGAGAAGCAGGCGCCGCCCAACCTCACGCTCCGCCCCTCCGCCTTCAAGGCCATCAACGACATCCACACC
CGCCTGCAGAGGGAGTGCGCCGCCGCCGTCGTCTCCTGCTCCGACGTCCTCGCGCTCGCCGCCCGCGACTCCGTCGTCGCG
GTGAGTAGTTAGCTATGCCTATACATGCATGCAAATTAA
ATACTTATGCAATAATTAATTCGCGCATATATGCAGTCGGGAGGCCCGAGCTACCGGGTGCCCCTGGGGCGGCGCGACAGCACCAGCTTCGCGACGCAGCAGGACGTGCTCGGCGGCCTC
CCGCCGCCCACCGCCACCGCCCCGGCTCTCCTGGCCGTGCTCTCCAAGCTCAACCTGGACGCCGCCGACCTGGTGGCGCTCTCCGGCGGGCACACCATCGGCCTCGGCCACTGCACCTCC
TTCGAGGGCCGGCTCTTCCCGCGCCAGGACCCGACCCTGAACGCCACCTTCGCCGGCCTCCTCCGGCGGACCTGCCCGGCCATGGGCACCGACCGGAGGACGGCGCTGGACGTGCGGACG
CCCAACAAGTTCGACAACAAGTACTACGTGAACCTGGTGAACCGGGAGGGGCTCTTCACCTCGGACCAGGACCTCTTCAGCAACGCCGCCACCAGGGACATGGTCGCCAGGTTCGCGCAG
AGCCAGAAGGCCTTCTTCGACCAGTTCGCGTCCTCCATGGTGAAGATGGGGCAGATCAAGGTGCTCACGGGGAAGCAGGGCCAGATACGCAGCAACTGCTCCGCGCGCAACAACCCAGCC
GGCCTGCTGCTGCCATGGTCCATCTCCATCCTCGACGACCAGGCCTTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCCTTGTTCTGCTTCGCTCGCTGCCGCAGTGGCGGCCGGCCTCCTCCTCATCTCCGGCGGCTGCGTCGTCGCCCAGCAGCCGCCGCCGGTGGCGCAAGGCCTGTCGTTCGACTTC
TACAAGCGGAGCTGCCCCAAGGCGGAGTCCATCGTGCGGAGCTTCGTGCAGGACGCGGTGCGCCGGGACGTGGGCCTCGCCGCGGGCCTCCTGCGCCTCCACTTCCACGACTGCTTCGTC
CAGGGCTGCGACGCCTCCGTCCTGCTCGACGGCTCCGCCACCGGCCCCGGCGAGAAGCAGGCGCCGCCCAACCTCACGCTCCGCCCCTCCGCCTTCAAGGCCATCAACGACATCCACACC
CGCCTGCAGAGGGAGTGCGCCGCCGCCGTCGTCTCCTGCTCCGACGTCCTCGCGCTCGCCGCCCGCGACTCCGTCGTCGCG
TCGGGAGGCCCGAGCTACCGGGTGCCCCTGGGGCGGCGC
GACAGCACCAGCTTCGCGACGCAGCAGGACGTGCTCGGCGGCCTCCCGCCGCCCACCGCCACCGCCCCGGCTCTCCTGGCCGTGCTCTCCAAGCTCAACCTGGACGCCGCCGACCTGGTG
GCGCTCTCCGGCGGGCACACCATCGGCCTCGGCCACTGCACCTCCTTCGAGGGCCGGCTCTTCCCGCGCCAGGACCCGACCCTGAACGCCACCTTCGCCGGCCTCCTCCGGCGGACCTGC
CCGGCCATGGGCACCGACCGGAGGACGGCGCTGGACGTGCGGACGCCCAACAAGTTCGACAACAAGTACTACGTGAACCTGGTGAACCGGGAGGGGCTCTTCACCTCGGACCAGGACCTC
TTCAGCAACGCCGCCACCAGGGACATGGTCGCCAGGTTCGCGCAGAGCCAGAAGGCCTTCTTCGACCAGTTCGCGTCCTCCATGGTGAAGATGGGGCAGATCAAGGTGCTCACGGGGAAG
CAGGGCCAGATACGCAGCAACTGCTCCGCGCGCAACAACCCAGCCGGCCTGCTGCTGCCATGGTCCATCTCCATCCTCGACGACCAGGCCTTCTAG

Retrieve as FASTA