Entry information : CtoCcP03
Entry ID 13470
Creation 2015-10-28 (Christophe Dunand)
Last sequence changes 2015-10-28 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-02 (Achraf Jemmat)
Peroxidase information: CtoCcP03
Name CtoCcP03
Class Cytochrome C peroxidase    [Orthogroup: CcP010]
Taxonomy Haptophyceae (prymnesiophytes); Prymnesiales; Prymnesiales; Prymnesiales
Organism Chrysochromulina tobin (sp. CCMP291)    [TaxId: 1460289 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CtoCcP03
start..stop
S start..stop
TpsCcP03 431 2e-152 71..374 64..331
OCgrCcP01 253 1e-83 71..285 14..223
PbrCcP01 241 4e-78 70..372 6..271
CatmCcP01_M2923 243 4e-78 66..374 73..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19477..19623 147 N° 2 18325..19302 978  
complement(join(18325..19302,19477..19623)


exon

Literature and cross-references CtoCcP03
Literature Hovde,B.T. et al., Direct Submission. Submitted (29-DEC-2014) Genome Sciences, University of Washington, 3720 15th Ave NE, Seattle, WA 98195, USA.
Protein ref. GenBank:   KOO27606.1 UniProtKB:   A0A0M0JM05
DNA ref. GenBank:   JWZX01002695.1 (19623..18325)
Protein sequence: CtoCcP03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   374
PWM (Da):   %s   40998.99  
PI (pH):   %s   6.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHGGKGFGGGEATRDPGPTYYDPNDPKGKQQAIHKAESFAEYLAKRGSAGSWSAVVSPRSRAVASPPAVDYAAVRKELKLMMDNPSWDDGSLAPIFIRLAWHSSGTFDKASGTGGSNGAGMRFSTEAADPENAGLNAARAFLEPVKKRFPAISYSDLWVLAAYVGLEHTGGPAIQFHPGRSDHQDENYWKEKGMSYGRLPAAEKYLGDEVDAEGRVVGWERLSNHVRHEVFYRMGFNDQEIVALLCGGHVYGRAHPKASGYAGPWVENPTVFSNEYAADMIEDEWFLVGHEDTWLDEQGAAELRPALGKRQYVNQKRGGQAGDHPNQMMLVSDMILAWDPGFRPHLEVYAQSEERLKEDFGKAFKKLTELGCGF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATGGTGGCAAAGGGTTTGGCGGTGGCGAGGCGACGCGAGACCCGGGACCGACCTATTACGACCCCAACGACCCGAAGGGCAAGCAGCAGGCGATTCACAAGGCCGAGTCGTTCGCC
GAGTACCTCGCCAAGCGCGGGTCCGCA
GTTAGTGGCGGCGCGACGCGAGACGCTGCTCCGCCACCGGCTCCGACTACACCCGTCGCATCGTCGCGCCCTGTGGCCAGGGTCCAACAGCGG
GATGCTCGGCGTGGCACCAGCTGGCACGACGGCGCAGCCTCCGCCACGAGCCACGATTTTCTTGGGAATTCAATGGTTCAGGGATCGTGGTCCGCGGTCGTATCACCCCGCTCCCGCGCG
GTGGCTTCGCCGCCGGCGGTCGACTATGCGGCCGTCCGGAAGGAGCTCAAGCTGATGATGGATAATCCTTCTTGGGATGACGGATCGCTTGCGCCCATCTTCATCCGGCTCGCGTGGCAC
AGCAGCGGCACGTTCGACAAGGCAAGCGGCACGGGCGGCTCCAACGGCGCGGGCATGCGCTTCTCGACCGAGGCAGCCGACCCAGAGAATGCCGGCCTCAATGCGGCGCGCGCGTTCCTT
GAGCCAGTCAAGAAGCGTTTCCCAGCTATCAGCTACTCGGACCTGTGGGTGCTCGCTGCGTACGTGGGGCTCGAGCACACGGGTGGCCCTGCGATCCAGTTCCATCCGGGCCGCTCCGAT
CATCAGGATGAGAACTACTGGAAGGAGAAGGGCATGTCGTATGGCAGATTGCCCGCCGCTGAGAAGTACCTCGGTGACGAGGTCGATGCGGAGGGGCGCGTCGTGGGCTGGGAACGCTTG
AGCAACCACGTGCGGCACGAGGTCTTCTATCGAATGGGCTTCAACGACCAGGAGATCGTCGCGCTGCTCTGCGGGGGCCACGTGTACGGCCGAGCCCACCCGAAGGCCTCAGGCTATGCA
GGCCCTTGGGTCGAGAATCCGACCGTCTTCTCCAACGAGTACGCAGCCGACATGATCGAGGATGAGTGGTTTCTGGTCGGCCACGAGGACACTTGGCTCGATGAGCAGGGTGCGGCCGAG
CTGCGGCCTGCTCTGGGCAAGCGCCAGTACGTGAACCAGAAGCGGGGCGGCCAGGCAGGTGACCATCCGAACCAGATGATGCTGGTCTCGGACATGATCCTCGCGTGGGACCCTGGCTTC
CGTCCGCACCTTGAGGTGTACGCGCAGAGCGAGGAGCGACTCAAGGAAGACTTCGGCAAGGCCTTCAAGAAGTTGACGGAGCTCGGCTGCGGTTTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATGGTGGCAAAGGGTTTGGCGGTGGCGAGGCGACGCGAGACCCGGGACCGACCTATTACGACCCCAACGACCCGAAGGGCAAGCAGCAGGCGATTCACAAGGCCGAGTCGTTCGCC
GAGTACCTCGCCAAGCGCGGGTCCGCA
GGATCGTGGTCCGCGGTCGTATCACCCCGCTCCCGCGCGGTGGCTTCGCCGCCGGCGGTCGACTATGCGGCCGTCCGGAAGGAGCTCAAGCTG
ATGATGGATAATCCTTCTTGGGATGACGGATCGCTTGCGCCCATCTTCATCCGGCTCGCGTGGCACAGCAGCGGCACGTTCGACAAGGCAAGCGGCACGGGCGGCTCCAACGGCGCGGGC
ATGCGCTTCTCGACCGAGGCAGCCGACCCAGAGAATGCCGGCCTCAATGCGGCGCGCGCGTTCCTTGAGCCAGTCAAGAAGCGTTTCCCAGCTATCAGCTACTCGGACCTGTGGGTGCTC
GCTGCGTACGTGGGGCTCGAGCACACGGGTGGCCCTGCGATCCAGTTCCATCCGGGCCGCTCCGATCATCAGGATGAGAACTACTGGAAGGAGAAGGGCATGTCGTATGGCAGATTGCCC
GCCGCTGAGAAGTACCTCGGTGACGAGGTCGATGCGGAGGGGCGCGTCGTGGGCTGGGAACGCTTGAGCAACCACGTGCGGCACGAGGTCTTCTATCGAATGGGCTTCAACGACCAGGAG
ATCGTCGCGCTGCTCTGCGGGGGCCACGTGTACGGCCGAGCCCACCCGAAGGCCTCAGGCTATGCAGGCCCTTGGGTCGAGAATCCGACCGTCTTCTCCAACGAGTACGCAGCCGACATG
ATCGAGGATGAGTGGTTTCTGGTCGGCCACGAGGACACTTGGCTCGATGAGCAGGGTGCGGCCGAGCTGCGGCCTGCTCTGGGCAAGCGCCAGTACGTGAACCAGAAGCGGGGCGGCCAG
GCAGGTGACCATCCGAACCAGATGATGCTGGTCTCGGACATGATCCTCGCGTGGGACCCTGGCTTCCGTCCGCACCTTGAGGTGTACGCGCAGAGCGAGGAGCGACTCAAGGAAGACTTC
GGCAAGGCCTTCAAGAAGTTGACGGAGCTCGGCTGCGGTTTCTAG

Retrieve as FASTA