Entry information : MmulGPx03
Entry ID 1349
Creation 2009-02-04 (Christophe Dunand)
Last sequence changes 2010-11-23 (Myriam Duval)
Sequence status complete
Reviewer Myriam Duval
Last annotation changes 2010-11-23 (Myriam Duval)
Peroxidase information: MmulGPx03
Name MmulGPx03
Class Animal glutathione peroxidase    [Orthogroup: Gpx1001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Cercopithecidae Macaca
Organism Macaca mulatta (rhesus monkey)    [TaxId: 9544 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MmulGPx03
start..stop
S start..stop
MfGPx03 466 4e-170 1..226 1..226
MfaGPx03 463 5e-169 1..226 1..226
MnemGPx03 462 7e-169 1..226 1..226
CapGPx03 461 2e-168 1..226 1..226
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 147434018..147434104 87 N° 2 147438692..147438845 154 N° 3 147440252..147440369 118 N° 4 147440791..147440890 100
N° 5 147441269..147441487 219  
join(147434018..147434104,147438692..147438845,147440252..147440369,147440791..1 47440890,147441269..147441487)


exon

Literature and cross-references MmulGPx03
Literature Magness,C.L., Fellin,P.C., Thomas,M.J., Korth,M.J., Agy,M.B., Proll ,S.C., Fitzgibbon,M., Scherer,C.A., Miner,D.G., Katze,M.G. and Iadonato,S.P. Analysis of the Macaca mulatta transcriptome and the sequence divergence between Macaca and human. Genome Biol. 6 (7), R60 (2005).
DNA ref. GenBank:   NC_007863.1 (147434018..147441487)
EST ref. GenBank:   CO774105
Cluster/Prediction ref. UniGene:   Mmu.9682
Protein sequence: MmulGPx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226 (202)
PWM (Da):   %s   25281.9 (22742.5)  
PI (pH):   %s   7.44 (6.52) Peptide Signal:   %s   cut: 25 range:25-226
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLLQASCLLSLLLAGFLPQSRGQDKSKMDCHGGVSGTIYEYGALTIDGEEYIPFKQYIGKYVLFVNVASY*GLTGQYIELNALQEELAPFGLVLLGFPCNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPVMRWHHRTTISNVKMDILSYMRRQAALGVKRK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 4 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCGGCTGCTGCAGGCGTCCTGCCTGCTCTCCCTGCTCCTGGCCGGCTTCCTCCCGCAGAGCCGGGGACAAGATAAGTCGAAGGTGAGTGAGCCTCCGGGCGGGGGGCCAGGAGAA
CAAACCTAGCCCCTCGGTGTCCAGCGCTTAGTGCAATGCACCCCTTTTCCCAGGCTCCCCGCCAGATGGGCGATCCCCAGGTGCGAGGGACCCCCTGAACCCTTTTGCCGCCGCGACCCC
GCCCCCGACCGTCGTCGTCTTGTAGTTCCATCTGTTGGAGAGCTGAAACCTGGTGCTTCAGGCGGGCAGAATGACTAAGGGAGGAAGGTCTCTTTCCCCCGAGCTCGCACTTTCTCCCCA
CTGCCACCTCGGGGATCGCCTTGCTACATCTATGTCACCTCCGTGCCTGAGCTGCTCCCCTTCAGTAGGACCTGAGAGGGAGGGCGTCACAGAAAAAATGCCTGGCGTCTGGGTGGGCTG
TGCAAGTTCCAAGGGAGACAGACAACGAGAAAGGGGAGAGGCAGCTGGGTGAGCCTGGTCCTGAAGAACTGCTGTGGGGGCTCTTCTAGTCCAGGAATGATACAGGCGGGTAGAAATGGC
CACTTGGATTCAGGGCATTGGTAGAAGAGGCAGAGATCAGTGCTAGAAAGAGCTCTGGAGTGGCAGTGCCGAACATTCAGGACCCTGAGTCCTTACCTGTTCCTGGACCCCCGTTTCTCC
ATCTGCAGGGGGGAGTTTGGGGGTGGGAGTGCATGGGGCACAATGAAGCTGAGGGCCTCATAGGGGATGCTTGGAGAAGCTGAAAAATCCACAAGCTGTTCTCTGCAATTTCCTCCTCTG
GGGCAGCCTCACTACCCAGGACCCACTGTCATTAGCCTGAGGAAACCTGGTAGTTGGAGAAAGCTGGGGACTGCTAATTCAGAAGGAGAGGTAGAATTCTCTGGAGCCTCGGTCTATTTC
CAGCAGGTGTGTGGCCCATACCTGGAGTGGGGATATTGAGGCCAAGAGCGGGAAGAGCCAGCATGCTGATCTCCTTGGACAGTGTGTGCCGGGGTGGGCTCTGTAGACCTCTCCTCTACC
CACTGAGTGGGAGTGGGTGGGGAAGGAGGCAGAAACCAGGTGTAGGGATAGACTCAAAGAGAGCAATTTCTGTCTCCAACCTCCCAACACGCATAACTCACATTTTTGCAAGCTCTGAGC
TTGTGTTTCTAAAATCCTCTGGGCCTTCACTTTAATTAAGATCTTACGAGTCTAGGAGTCTGTTTCCAAAATTCTATCCACTTCTCAGGAAGCCCATTGCAAGCACAGGCTTCCTTCCAT
GTTACTCACCCCCTTTCTGTCCTCAGCCTAAATCCCATTAATCAGCCTCTCCTTGGAGTCAGTCTAAATGGATGTGAAGCCACTTTGTCCAAGCCCCCTCCTTTTTTATCCATCCCTGTT
CATAATCCCCAACTCAGAAGGCATTTTCCAGGTCAGGAATGGGGTCGATTTTCAACACTGATGTTGGGGGTGGGCCATAGACAGGCCAGCACCATGGAGTGAGTCCCAACCTCTCAGACT
GGGGAGGGTCAAAGAAGGTACGAATTGGGCCCTGCCTCAAGAAGGCTAGCGGGGAGAACCTGGACTCTATGAATAACTCATCATAGCTATGTCTTCTCTGCAGAACTCTGGGGAGGGATA
AATGGACTCAGAGAGAATAGGATGGGGATGGTCTAGAAAAGTTTTAGGGTGAGGTATAATCATATCACATACAACTAGTCAGGACTTGCTGGCTAATGAAAGCCTGGACATGCCCATCTC
TGCTCCCAAGTTCTTACAGTTGAGATGTCTTAGCTCTGGGTTAGGACCCAACCACTCATCTCACCCCCAACCCCAGGGTAAAGGGATAGGGTTATGGGGCATGTGGAGAATGGAATGGAT
GAAAGGGGACTCAGCCCCAGAGAGGTGTTTGCCTCCTACCAATTCAAAGGAAGAGGCTAGGGAACAGATGGGGTCCTCCTCTTCTTGCTGCATCCCCTCCCCAGTCCAACTTCAGGCTGC
CCAGGCTCCTTGTCTCTACAAAAGGACTGCAGAAGCCGGAAAGAGTGACAACTGCTGACGTGCATGGGATCCTAGTAACCGCTGGTTTCTAGGTGACTAAACCTGACAGAGAGAATCATG
GAACCACAGGCTGACAGAGTTAAAGGGCCTTTAAGACAGCCCTGAACCTGACTCCATCTTACAATGGAGGAGCCGGAGCCCCAGGAAAGGGGGTCACATGGCATCAGAGACACAGCAAAG
CCCAGCACTCAGGTCTCCAGCCTCCCAGACCACTTCTCACAGATCATATTGATAGCAGTGGTAAGACAGGAGAGGAGAAAGACACAAGACCAGCAGCCCCAGCCAGCCAGAGTCCTGGCT
GAGTCCCATCATCCAACTTTCAAGCCACCAGAACCCTCCTCTCTTGCCCAGCTATGGGAGGATTGAGGCACTGTCATGGCCTCTCCCCGTTATCTCCTTCAGCCACTGTTTCAGATGCAG
TGCTCTGGGATTCCATGTGCCCAGAGAAGGGAAGGGGACTCATAGAGGACTGAGTTGCAGTGGTCAGTGGGGAGCACAGCTGTGGCTTCTCCACCCGTGGGCCACCTTCTGACCCCCACT
ATCCCTTGACATGGGATTTTGTTCCAAGAGATTCTATGCCTGTTTTGTTCTGCCAATAGATTCTCCCAACCGTTCTGGGCAGCAGCATGCTTATCTCCCTGGACATTATATGCCCGGACA
GTGAAAGTGACTTGCTCAGAGCCACACAGCCAGCAAAAACCAGAAGCGAATGAAATAGGGTTCTCCTTGCCACACCCCCAAACTGAAACTGTGCCCAGAAGCTGGTCCTTCTGTTTACAA
GCTCCCATTATTAGGACAACCTGTCATCTCTTTTTCTTCCATGTCTCGGAGTTCATTTTTGGGTCATGGCAGAGTTAAAAAAGTGAACAGGCTATAGAGATGCCCGGCTTTCTGGCCACT
AGACCTTTGTGGCGGTCTAGGGTATATGTGTTGTGCCCCAGTCTGTCTGCATTTTAAGGTGGAAATGGCCCCAGCTGGAACGAGGAGCTCCAGGAGCAGGAGGAATGTTGATCTTAGGTC
TTGGGCCTGCCTCCAGCACCCACCAAAAGTCACAGGGTATGGAATATTAGACTCATGTAAAGCAGGAAGTTTGCACCAGTGCCAAGAAGAGAGCTTGCAGCTGCCAGGGAATGGCCTGGC
GGAGGAAGCGCAGCCTCGCCCGGCTCAGCAGGCCTGCTTCATGACAGAGGTATCTCTTCTGCATCCTGCGCAGGGGCCACACTCTGCCAGCATGGATCACTCCCTTCACCTGGTCAGGCC
CAGGTTCCTTGCCTCAACAGCAAGTTCTCCAGAACTGAGGGGAAGAGAGGGAGTGAATTTGCTGTTCTAACTCCAGCCACCTGTCTCTGCCCTCTCCTGGTCTATAATGCTGCTTTGCAT
TCCATTTGTTTATTGTCTGCCCACCTTTCAAAGGATATCAAGGCCACAAAGGACCTTAAAGATCACCTTATACAATGGTTTCAAGGTTTTTCCTTTCCCATCACGACCAGCCCACCTGCC
AAATTATGTCAATGATGCAATGACAGACATCCTTTCAAGGGTAGTCTCAGAGTTTTGTTGTCTGTGTCAGGGATGAGGTAGAGGCAGAGTAGGCTCATAAGCCACATCCTACTAGCCAGC
AGTGAGCCCAGTCCCCCCTTTCCCACTGATCATGATCCTATCAAGCCATCATGGTTGACCTGGTTGAAGAGCTGGTTCGGTTCAAGGTTCTCATTTTATAAACGAGGAAACTCAGGTCCG
AAGAAAAGAAAGGGTCAGTCCAAGACCACACAGGGAGTTAATGGCAGACGGACGTGGAGCCCAGGTCTCCCAGCCCACAGTCCACTGTACTCTGTCCCTCCTTGTCCTGGAGGCTGACTG
TGAGCAGCAGCTGGGGAGGGAGGAAGGCATAAGGGTCATCACCAGCCTGCTCAGGCCCGGAACATTAACACCTGCAGGTATTGTTGCTTTTCCCTACCTTGCCCAGCCCTTTCCCCCATG
CCTGGCTCTCAGTCCTGCTTCCCTATTTGGTAACAACAGCCTCATCTTTCCTGTCCTCCAGATTGGGAGCCTCTGAATGACCATGTCCATACTGCCTCTGCCTCCTTTCTGTTCAGTTTT
TCCTTCACACTGGCCTAGTTCAGGCTCTCATCCTCAATGGCCTGGAGTATCCCAACAGCCACCCGACCAGTCTCCATCAGCCCGTCCAGGAACCCAGCCATCAGCTTTAGGGCAGTCTCC
CTAAATAACTTCAGTAAATATTCTGAAGTTGACATGTGATGTGGAAGTAATTAGCAAAGTAAGTCATTCTCTAGGGTTCCATAGCACTCACTTATTAAGTGCTTATTAAGCACTTAAGCA
CTCACGTATTAAGCACTTAATAGTAAGCACCTAATAAGCACTTATTAAGTGCTTTCAAAATCATTATCTTACACAAGGAATTAGGAGACCTCAGTGCTAGTCCAGTTCCAATTCTCGGGG
ATGATTTTGAGAAAGTCACTTTCCCTGTTGGGATCTTTCATTCTTTTGAAAATGGAGATGTCCAAGTTCCCTTCCAGCTCTAACTGCTCCTTTTATGGCCTTTCTGTGTTCCAGATGGAC
TGCCATGGTGGCGTGAGCGGCACCATTTACGAGTATGGAGCCCTCACCATTGATGGGGAGGAGTACATCCCCTTCAAGCAGTACATTGGCAAATACGTCCTCTTTGTCAACGTGGCCAGC
TACTGAGGCCTGACGGGCCAATACATTG
GTAAGAGCCCACCCTTCCTCCCTGCTTTATTTGGGGCTGTATGGCATATTTCAATCACAGGATCTTTTCTGGTGCACAGGGGGAAGGGTGAT
GGCAATCATGAGAGTCCAAGCCCCTTTTCCCAGCTCCACCGTGTTCTGTGGTTTTGTGAAGATGATTATATAAGCCTGAGGTCTGATTGCCTCTGGACATGTTCTAGGAGATTCCCAGTT
ATCTGTCTTCATCTCTGGGCACCTCAACCACCCTAAAGGCAGAGGGATGGAGATTCGGTTTGTGATTAGAGCTCCCTTTGGCTGGAGCATGAGATGGTAACTGGAGCTCCATCTTGCTGA
GAATGTCTCATTTTCCCTCAGCCCCATCTGCTTCGGTGCTTCTCTTGGCAGCTCTCTGGAACTCTGGCCTCTGGCAAATTGCCTTGAGGCCCCAGAGTGTATGCATGGTGTAGTGGGATG
AAGGGGCAGGCTACATTTCTAATGCCCATTCTAAAATAAACTTTGAAGATGATCTAGTTTAGCCTTCTCCCCTTCTCAATTTACAGATAGGAGACCAAGACTCAGAGTGAAACACAACTT
AAGCAGAGTCAGAAAGCTATTAGTGGCGGAATGGGGCATTTGGCCCAGGTTTCATGATCTCCTGATATGCTTACTCCTTTCTCCCTAGCTGGGGTAGAATACAGAGGCTAGGGGAACAGG
CAACCAAAGGCAAGCGACAGCACCCAGGGGAAAACGCTCTGGGGCTGAGCAGTCTGCTGGCAGGGGGTCAGGGAGGCAAGGACAATTTGACCCTCTATGCTCTGCCTGGCAATCAGGCGA
ATTCCCGTAAGCGGAAGGACGGTGGTCGCGTGGTCCAGTGGCTGTGAGTGCTGTGTCTGGGATGCTTCTCTCTAGCCTTGGAACAGAGCACAGTGCGTTTGGGCAAGAGATGGGCTGGGT
GCTGCTGCAAAAGAGACCAGGGGACACTGAGGAAACTGGGGAGCTGGGCCAGGGCCTCATCTGTGTTCCTGATTTGCCAAAGATTATGGGAGGGTTGTAACCTCACCCCAAAGGTCTCTG
CCTTGTATCCAGGGATGGATAGTTCTTGCTCCAGGAAACTCAATCCTGAGGGCCCTGAATGAGTGCTCCAATTGGCCCAGGTGGAGGGCCTTGGCAATGGGCAGGTGACTGACAGCTGAT
TTGAGGAAGGGTATTCTTTTCCCCCAAACCTCCAATCCATCCTGATTTAGAGTCAAGAGGATAGGACCTGAGTCCCAGCATTGCTGTGAACTCACTGGTGATCTTGGGCAAGTCCCTCCC
TTTCTCGGGCCTCAGTAGTTCCAGTGGCACAGCAGGTGAGCTGGGGGAGTGGTGTGGATGAGACAGGGCTCCTTGCCAGGATACTCCCATGTCTGCTCTTTCTCTTTGGCCCAGAACTGA
ATGCACTACAAGAAGAGCTTGCACCATTTGGTCTGGTCCTTCTCGGCTTTCCCTGCAACCAATTTGGAAAACAGGAACCAGGCGAGAACTCAGAGATCCTTCCCAGCCTCAA
GTGAGTGC
TCACTCAGCATCCTAAGAAAGCACCTCTCACATGGCCCATGTGTCTTGTATCAACCCCAATTCATGGTGAACATTTATCAGCCACCAAGAACCACTCTCCTCTTCTAGGATCCCCAGTGA
AATGAGGGAATGGAAGGGAAGGGACAAAAGAGGGAAAAGGACAGACATGACTAGTTGTGATGTGCATCTGCGGGGAGCACCGAGGTGGGGGGACACTGAAAAGGGACCAGGCTGGAAAGG
AAGACCGCGGACTCACATTATGCCTACACCCACTGCACATTCACTGGCTCCTCCTTCCCACTGCGGAATAAATCCAGACCCCCAACACCCCCCTCCCCTGTTCTGTCCCTTCCTCTCATT
TCTGAGCCCTGTGCCCACCTCCTTGGAACCCACCTAAGAACATTCCTCAACAGGTATGTCCGACCAGGTGGAGGCTTTGTCCCTAATTTCCAGCTCTTTGAGAAAGGGGATGTGAATGGA
GAGAAAGAGCAGAAATTCTACACTTTCCTAAAG
GTGAGTGAGCTCCCACCTGTGTTGGCTGGGACTGCAGCCCCTCTTGGCTCCAGTCCACACCATGAAGGCCATGCCACCTCCCCTGCT
CCTGGGCTCTTAGGGAATTTCTTGGTATCTATTGTTCCAGCTAGAGGGCTCTGCAGACCCTGACTATTGGCCCATTTTACAGGAAAGGCCCAGAAGGAGGACCCAGAGTGAACATACTAA
GGGTTTCACAATCTTCTAGAGCCACAGCTGGCACTGGCAGTCAGTCTTCTAACTCCCAAACTGGGGCTCTTTTCTCAGGGCCAGGCTGTTCTCCCACCCCAGGAAGGTCTAGGAAGGAAG
AGGGTCGGGTGGCCTCAAGCAAGGTTGACACTCCTCTCATCCCTGCTCTAGAACTCCTGTCCTCCCACCTCGGAGCTCCTGGGTACATCTGACCGCCTCTTCTGGGAACCCATGAAGGTC
CACGACATCCGCTGGAACTTTGAGAAGTTCCTGGTGGGGCCAGATGGTATACCTGTCATGCGCTGGCACCACCGGACCACGATCAGCAATGTCAAGATGGACATCCTATCCTACATGAGG
CGGCAGGCAGCCCTGGGGGTCAAGAGGAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCGGCTGCTGCAGGCGTCCTGCCTGCTCTCCCTGCTCCTGGCCGGCTTCCTCCCGCAGAGCCGGGGACAAGATAAGTCGAAGATGGACTGCCATGGTGGCGTGAGCGGCACCATT
TACGAGTATGGAGCCCTCACCATTGATGGGGAGGAGTACATCCCCTTCAAGCAGTACATTGGCAAATACGTCCTCTTTGTCAACGTGGCCAGCTACTGAGGCCTGACGGGCCAATACATT
G
AACTGAATGCACTACAAGAAGAGCTTGCACCATTTGGTCTGGTCCTTCTCGGCTTTCCCTGCAACCAATTTGGAAAACAGGAACCAGGCGAGAACTCAGAGATCCTTCCCAGCCTCAAG
TATGTCCGACCAGGTGGAGGCTTTGTCCCTAATTTCCAGCTCTTTGAGAAAGGGGATGTGAATGGAGAGAAAGAGCAGAAATTCTACACTTTCCTAAAG
AACTCCTGTCCTCCCACCTCG
GAGCTCCTGGGTACATCTGACCGCCTCTTCTGGGAACCCATGAAGGTCCACGACATCCGCTGGAACTTTGAGAAGTTCCTGGTGGGGCCAGATGGTATACCTGTCATGCGCTGGCACCAC
CGGACCACGATCAGCAATGTCAAGATGGACATCCTATCCTACATGAGGCGGCAGGCAGCCCTGGGGGTCAAGAGGAAG

Retrieve as FASTA