Entry information : ObrPrx01
Entry ID 13522
Creation 2015-12-15 (Qiang Li)
Last sequence changes 2016-02-01 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-01 (Achraf Jemmat)
Peroxidase information: ObrPrx01
Name ObrPrx01
Class Class III peroxidase    [Orthogroup: Prx060]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Oryza
Organism Oryza brachyantha    [TaxId: 4533 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ObrPrx01
start..stop
S start..stop
OsPrx95 541 0 18..358 20..361
TurPrx11-A 480 2e-171 23..356 23..361
TaPrx11-1D 477 4e-170 23..356 23..362
AtaPrx11-1D 476 6e-170 23..356 23..362
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 213631..214038 408 N° 2 214162..214327 166 N° 3 214774..215276 503  
join(213631..214038,214162..214327,214774..215276)


exon

Literature and cross-references ObrPrx01
Literature Chen,J. et al., Whole-genome sequencing of Oryza brachyantha reveals mechanisms underlying Oryza genome evolution. Nat Commun 4, 1595 (2013).
Protein ref. GenBank:   XP_006658197.1
DNA ref. GenBank:   NC_023169.1 (1..1646)
mRNA ref. GenBank:   XM_006658134.1
Protein sequence: ObrPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358
PWM (Da):   %s   36860.92 Transmb domain:   %s   i7-29o335-357i
PI (pH):   %s   6.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAGVVGLRGIAVAVVVVGLVSSAAAHVFVGAYNKTCPQAEEMVYKEMTDILGKSPEVGGAILRLFSVDCFVGGCEGSILLNSTPGHTAEKDSPLNKGVRGYEVVDAIKAKLDAACPGIVSCSDTLALAARDAVRLRKGPYIPLPTGRRDGNTSNAADVGPNSPAPGATVSDLLTLFAKFNFTAKDLVVLSGAHTIGKAHCSTISPRLYGNASVPDPPLDANYTAALRGLCKPGDADTLVDLDPGSPATFDTDYYKQVATQRGLLSTDAALLLNADTRAYVLRQANATSDDEFFSDFIVSFVNMSKIGVLTHSHGEIRQKCSAVNPPSSSPSTSAAAIATSLAGSLLFLLAGALVLLF

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 2 and 3) and EST. Contain SVDC.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGGGAGTAGTAGGATTGCGAGGCATAGCGGTGGCGGTGGTGGTGGTAGGGCTGGTGTCGTCGGCGGCGGCGCACGTGTTCGTGGGGGCGTACAACAAGACGTGCCCGCAGGCG
GAGGAGATGGTGTACAAGGAGATGACGGACATCCTGGGGAAGTCGCCGGAGGTGGGCGGGGCGATACTGAGGCTGTTCTCGGTGGACTGCTTCGTGGGCGGCTGCGAGGGCTCCATCCTG
CTCAACTCGACGCCGGGCCACACCGCGGAGAAGGACTCGCCGCTGAACAAGGGGGTCCGCGGCTACGAGGTGGTGGACGCCATCAAGGCCAAGCTCGACGCCGCCTGCCCCGGCATCGTC
TCCTGCTCCGACACGCTCGCCCTCGCCGCCCGCGACGCCGTGCGCCTG
GTACGTATTGCCGGATCGAGTCGAGTGCGCGCCGCGCGTACCTGGTCGGAGTTAGCTAGTTAGCTATAGCTA
ATGATACATATATATATATAATATATATGGATGGATATGTACTACCTGCAGAGGAAAGGGCCGTACATCCCACTTCCGACAGGGCGGAGAGATGGCAACACCTCTAACGCCGCCGATGTG
GGGCCCAACTCTCCTGCCCCCGGCGCCACCGTCTCCGACCTCCTCACCCTCTTCGCCAAGTTCAACTTCACCGCCAAGGATCTTGTCGTCCTCTCCG
GTATATACGCGCGCGCGTACTCC
TATTATTATATGGGTCTTTTTTTTTAATATTTAAAAAAATATCTTGAGGTATTTTTAAAAAATTCTAATGTAGAATTTTAGTATCTTAAATACAAATAATAATAAATTAAAAAATATGGT
ACATCATCGGAGTATATTTTTAAAAATGATAAAAAAAAGCTCTTATTTTATACATGTACATACTCCTCCCAATATATATAATATAAAAATCGATTTTCATTTCACCGCCAGCCAAGGATC
GATCTTGGTTATGTAGTAGTACTGATTTACCCACGCCACTTATATAATAATGAATTAAATCAAATATCTCTCAGTTGTGGTTACAACTACAACTGAGGGCTTCCTGTTGGGCCGGGCTTC
CATCGTGTCGTAACTTAACTATGGGCCGGGCTTAAATCAAAAAGGAATGAAATGGAATGGCAGGTGCGCATACCATCGGCAAGGCGCACTGCTCCACCATCTCCCCCCGCCTCTACGGCA
ACGCCTCCGTCCCCGACCCCCCGCTCGACGCCAACTACACGGCGGCTCTCCGCGGTCTCTGCAAGCCTGGCGACGCCGACACCCTCGTCGACCTCGACCCCGGCAGCCCCGCCACCTTCG
ACACCGACTACTACAAGCAGGTGGCCACGCAGCGTGGCCTCCTCTCCACCGACGCCGCGCTGCTCCTCAACGCCGACACCAGGGCCTACGTCCTCCGCCAGGCCAACGCCACCTCCGACG
ACGAGTTCTTCAGCGACTTCATCGTCTCCTTCGTCAACATGAGCAAGATCGGCGTGCTCACGCACTCCCACGGCGAGATCAGGCAAAAGTGCTCCGCCGTCAACCCGCCCTCGTCCTCGC
CCTCCACCTCCGCCGCCGCCATCGCCACCTCGCTCGCCGGCTCGCTCCTCTTCCTCCTCGCGGGTGCCCTCGTGCTGCTCTTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGGGAGTAGTAGGATTGCGAGGCATAGCGGTGGCGGTGGTGGTGGTAGGGCTGGTGTCGTCGGCGGCGGCGCACGTGTTCGTGGGGGCGTACAACAAGACGTGCCCGCAGGCG
GAGGAGATGGTGTACAAGGAGATGACGGACATCCTGGGGAAGTCGCCGGAGGTGGGCGGGGCGATACTGAGGCTGTTCTCGGTGGACTGCTTCGTGGGCGGCTGCGAGGGCTCCATCCTG
CTCAACTCGACGCCGGGCCACACCGCGGAGAAGGACTCGCCGCTGAACAAGGGGGTCCGCGGCTACGAGGTGGTGGACGCCATCAAGGCCAAGCTCGACGCCGCCTGCCCCGGCATCGTC
TCCTGCTCCGACACGCTCGCCCTCGCCGCCCGCGACGCCGTGCGCCTG
AGGAAAGGGCCGTACATCCCACTTCCGACAGGGCGGAGAGATGGCAACACCTCTAACGCCGCCGATGTGGGG
CCCAACTCTCCTGCCCCCGGCGCCACCGTCTCCGACCTCCTCACCCTCTTCGCCAAGTTCAACTTCACCGCCAAGGATCTTGTCGTCCTCTCCG
GTGCGCATACCATCGGCAAGGCGCAC
TGCTCCACCATCTCCCCCCGCCTCTACGGCAACGCCTCCGTCCCCGACCCCCCGCTCGACGCCAACTACACGGCGGCTCTCCGCGGTCTCTGCAAGCCTGGCGACGCCGACACCCTCGTC
GACCTCGACCCCGGCAGCCCCGCCACCTTCGACACCGACTACTACAAGCAGGTGGCCACGCAGCGTGGCCTCCTCTCCACCGACGCCGCGCTGCTCCTCAACGCCGACACCAGGGCCTAC
GTCCTCCGCCAGGCCAACGCCACCTCCGACGACGAGTTCTTCAGCGACTTCATCGTCTCCTTCGTCAACATGAGCAAGATCGGCGTGCTCACGCACTCCCACGGCGAGATCAGGCAAAAG
TGCTCCGCCGTCAACCCGCCCTCGTCCTCGCCCTCCACCTCCGCCGCCGCCATCGCCACCTCGCTCGCCGGCTCGCTCCTCTTCCTCCTCGCGGGTGCCCTCGTGCTGCTCTTCTGA

Retrieve as FASTA