Entry information : RfAPx01
Entry ID 13529
Creation 2016-02-26 (Mbadinga)
Last sequence changes 2016-02-27 (Christophe Dunand)
Sequence status partial
Reviewer Mbadinga
Last annotation changes 2016-02-29 (Mbadinga)
Peroxidase information: RfAPx01
Name RfAPx01
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Foraminifera Reticulomyxidae Reticulomyxa
Organism Reticulomyxa filosa    [TaxId: 46433 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RfAPx01
start..stop
S start..stop
BnaAPx01 114 2e-32 1..145 113..234
PmariAPx01 108 6e-30 1..137 170..289
KmAPx01 104 6e-28 1..145 212..336
PmariAPx02 103 9e-28 1..137 202..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2878..3120 243 N° 2 2643..2837 195  
complement(join(2643..2837,2878..3120))


exon

Literature and cross-references RfAPx01
Protein ref. GenBank:   ETO07390.1 [3' end]
DNA ref. GenBank:   ASPP01026199.1 (3243..2643) [3' end]
Protein sequence: RfAPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 145
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
16711.64  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
10.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GRAFAERSGTVKEGYGPNKATQFTKAPHKPRHDGKEGLGMSGGRSFTVHWLDFDDEYFNFDKVLFLVAKKKKKNKLKIYVSVKDSDKDKLLQLSTDKVLFVDDNFKKYTQLYASDRERWFQDYIKAHQRLAELGSKFNPPNGFYL*

Retrieve as FASTA  
Remarks Partial sequence from genomic (1 intron detected). 5' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTCGTGCTTTTGCGGAGCGCTCTGGAACTGTGAAGGAAGGCTACGGACCCAATAAAGCCACCCAATTTACCAAAGCGCCACACAAACCTAGACACGATGGAAAAGAAGGGCTTGGCATG
TCTGGAGGTCGCAGTTTTACTGTACATTGGCTGGACTTTGATGACGAGTATTTCAACTTTGACAAAGTTTTGTTCCTCGTTGCAAAAAAAAAAAAAAAAAACAAACTCAAAATTTATGTT
AGT
GTTTGTTTGTAATATATGTGATGTGCTTGTTATTTGAAAGGTGAAAGACTCGGACAAAGACAAGTTGTTGCAACTGTCCACCGATAAGGTCTTGTTTGTTGATGACAACTTCAAGAA
ATACACCCAACTTTATGCCAGTGATCGTGAGAGATGGTTCCAAGATTACATTAAGGCACATCAACGACTCGCTGAGTTGGGATCAAAGTTCAATCCTCCTAATGGATTCTATTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTCGTGCTTTTGCGGAGCGCTCTGGAACTGTGAAGGAAGGCTACGGACCCAATAAAGCCACCCAATTTACCAAAGCGCCACACAAACCTAGACACGATGGAAAAGAAGGGCTTGGCATG
TCTGGAGGTCGCAGTTTTACTGTACATTGGCTGGACTTTGATGACGAGTATTTCAACTTTGACAAAGTTTTGTTCCTCGTTGCAAAAAAAAAAAAAAAAAACAAACTCAAAATTTATGTT
AGT
GTGAAAGACTCGGACAAAGACAAGTTGTTGCAACTGTCCACCGATAAGGTCTTGTTTGTTGATGACAACTTCAAGAAATACACCCAACTTTATGCCAGTGATCGTGAGAGATGGTTC
CAAGATTACATTAAGGCACATCAACGACTCGCTGAGTTGGGATCAAAGTTCAATCCTCCTAATGGATTCTATTTGTAA

Retrieve as FASTA