Entry information : TocAPx01
Entry ID 13532
Creation 2016-02-26 (Mbadinga)
Last sequence changes 2016-02-27 (Christophe Dunand)
Sequence status partial
Reviewer Mbadinga
Last annotation changes 2016-02-29 (Mbadinga)
Peroxidase information: TocAPx01
Name TocAPx01
Class Ascorbate peroxidase     [Orthogroup: APx002]*
Taxonomy Eukaryota Bacillariophyta Coscinodiscophyceae Thalassiosiraceae Thalassiosira
Organism Thalassiosira oceanica    [TaxId: 159749 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TocAPx01
start..stop
S start..stop
TpsAPx02 491 2e-177 3..309 24..330
PtrAPx01 442 6e-158 8..309 31..331
GtAPx02 404 3e-142 5..307 55..358
GtAPx01 369 1e-128 17..298 57..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..90 90 N° 2 172..1011 840  
join(1..90,172..1011)


exon

Literature and cross-references TocAPx01
Protein ref. GenBank:   EJK51156.1
DNA ref. GenBank:   AGNL01042126.1
Protein sequence: TocAPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   309
PWM (Da):   %s   32540.71  
PI (pH):   %s   4.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
VNKPLRPASSLSVTQGDLDGAQSMIDGILTEKNCGPVFVRLAWHDSGTHDVSLADKEWPASGGAIGSIRFDPEINHGANAGLAGAIKLLEPVKEAFPGVSYADIFQMASARGIALAGGPEIDMKYGRVDATSPEECSPEGNLPDAEAGPEGKFGGPGGTASTEDESAAWHLRKVFYRMGLDDEGIVALSGAHTFGRAYADRSGVGAEKTKFTDGSATKLADGSETTAYTAGGSPWVEDWLVFNNSYFTTINDASTDEELVKCTSDKCLWEDAGFAPFANKFADQEAFFESYAKAHKALSELGSKFEPIE*

Retrieve as FASTA  
Remarks Partial sequence from genomic (1 intron). Short 5' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTAACAAGCCGCTCCGCCCGGCTTCGTCTCTGTCCGTTACCCAGGGCGATCTCGATGGAGCTCAGTCGATGATCGACGGTATCCTGACGGTACGAACTTACTTGCAGCAAAGAGAGCGA
ATGAAATGACCGGTGAACTAACTGAGTTTCTTTGCATCCTGCAAATTACAGGAGAAGAACTGCGGACCCGTCTTCGTTCGTCTCGCGTGGCACGACTCGGGAACCCATGATGTGTCCCTT
GCTGATAAGGAGTGGCCCGCCTCCGGCGGTGCTATCGGATCCATCCGATTCGATCCCGAGATCAACCACGGCGCCAACGCCGGACTCGCTGGGGCCATCAAGCTCCTCGAGCCCGTCAAG
GAGGCCTTCCCGGGAGTCTCCTACGCTGACATTTTCCAGATGGCTAGCGCCCGCGGAATCGCTCTTGCCGGCGGACCCGAGATCGACATGAAGTACGGACGTGTCGATGCCACCTCGCCC
GAGGAGTGCAGCCCCGAGGGAAACCTCCCCGATGCCGAGGCCGGGCCCGAGGGCAAGTTCGGTGGTCCCGGAGGAACCGCGTCCACCGAGGACGAGTCCGCCGCGTGGCACCTCAGGAAG
GTCTTCTACAGGATGGGACTTGATGACGAGGGCATCGTCGCCCTTTCGGGAGCCCACACCTTCGGCCGAGCCTACGCCGACCGAAGTGGAGTTGGTGCCGAGAAGACCAAGTTCACTGAT
GGAAGCGCCACCAAGCTCGCTGACGGCAGTGAGACCACTGCTTACACCGCGGGAGGTTCCCCGTGGGTCGAGGACTGGTTGGTCTTCAACAACTCCTACTTCACAACTATCAACGACGCC
TCCACTGACGAGGAGCTCGTCAAGTGCACTTCTGATAAGTGCCTCTGGGAGGACGCGGGATTCGCCCCCTTCGCCAACAAGTTCGCTGATCAGGAGGCCTTCTTCGAGTCTTACGCCAAG
GCCCACAAGGCCCTCAGCGAGCTTGGTTCCAAGTTCGAGCCGATTGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTAACAAGCCGCTCCGCCCGGCTTCGTCTCTGTCCGTTACCCAGGGCGATCTCGATGGAGCTCAGTCGATGATCGACGGTATCCTGACGGAGAAGAACTGCGGACCCGTCTTCGTTCGT
CTCGCGTGGCACGACTCGGGAACCCATGATGTGTCCCTTGCTGATAAGGAGTGGCCCGCCTCCGGCGGTGCTATCGGATCCATCCGATTCGATCCCGAGATCAACCACGGCGCCAACGCC
GGACTCGCTGGGGCCATCAAGCTCCTCGAGCCCGTCAAGGAGGCCTTCCCGGGAGTCTCCTACGCTGACATTTTCCAGATGGCTAGCGCCCGCGGAATCGCTCTTGCCGGCGGACCCGAG
ATCGACATGAAGTACGGACGTGTCGATGCCACCTCGCCCGAGGAGTGCAGCCCCGAGGGAAACCTCCCCGATGCCGAGGCCGGGCCCGAGGGCAAGTTCGGTGGTCCCGGAGGAACCGCG
TCCACCGAGGACGAGTCCGCCGCGTGGCACCTCAGGAAGGTCTTCTACAGGATGGGACTTGATGACGAGGGCATCGTCGCCCTTTCGGGAGCCCACACCTTCGGCCGAGCCTACGCCGAC
CGAAGTGGAGTTGGTGCCGAGAAGACCAAGTTCACTGATGGAAGCGCCACCAAGCTCGCTGACGGCAGTGAGACCACTGCTTACACCGCGGGAGGTTCCCCGTGGGTCGAGGACTGGTTG
GTCTTCAACAACTCCTACTTCACAACTATCAACGACGCCTCCACTGACGAGGAGCTCGTCAAGTGCACTTCTGATAAGTGCCTCTGGGAGGACGCGGGATTCGCCCCCTTCGCCAACAAG
TTCGCTGATCAGGAGGCCTTCTTCGAGTCTTACGCCAAGGCCCACAAGGCCCTCAGCGAGCTTGGTTCCAAGTTCGAGCCGATTGAGTAA

Retrieve as FASTA