Entry information : SlemAPx01
Entry ID 13534
Creation 2016-02-26 (Mbadinga)
Last sequence changes 2016-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Mbadinga
Last annotation changes 2016-02-29 (Mbadinga)
Peroxidase information: SlemAPx01
Name SlemAPx01
Class Ascorbate peroxidase    [Orthogroup: APx012]
Taxonomy Eukaryota Spirotrichea Oxytrichidae Stylonychia
Organism Stylonychia lemnae    [TaxId: 5949 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SlemAPx01
start..stop
S start..stop
OtriAPx01 459 9e-166 1..275 1..273
ShisAPx01 335 1e-117 66..275 1..208
EvanAPx01 226 3e-74 1..249 1..242
CbrebAPx03 216 6e-70 7..243 17..246
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 902..1026 125 N° 2 165..867 703  
complement(join(165..867,902..1026))


exon

Literature and cross-references SlemAPx01
Protein ref. GenBank:   CDW77073.1
DNA ref. GenBank:   CCKQ01005810.1
Protein sequence: SlemAPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   276
PWM (Da):   %s   31603.25  
PI (pH):   %s   6.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNINHIAKKPFFDLFYRSPCMALMLRAAFHDAGTFCKNSKTGGPRGTLRHSHDLDRPENAGLDFAMDQIEEIKDEGNHITAMLSYSDLIQLGGYTAVEYTGGPVMLFRMGRKDAEDHDEHTPEDRLPDVREGSSNILTKMHRMGFTTQEFVALMGSHTLGFAHQDRTGFQGRWTQNPHVFDNTYYKEVLLGERSKFLKTPVEHMLAQNSEMKKLCEAYAQDQNLFFEHYALAHVKMSELGQEEHLLSEFEENQPKYKLPESSYLQLNSFSDPQKY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Specific codon usage
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATATTAATCACATCGCAAAGAAGCCATTCTTTGATTTATTCTATAGATCACCATGCATGGCTCTTATGCTCAGAGCAGCCTTCCATGATGCTGGTACTTTCTGTAAAAACTCAAAA
ACTGG
GTACTCATAATTCCATATCTAATAACTTTGATAGGGGACCTAGAGGTACTTTAAGACATAGTCACGATTTGGATAGACCTGAAAACGCTGGACTTGATTTTGCGATGGACTAAAT
TGAGGAAATCAAGGATGAAGGAAACCATATCACTGCTATGCTTTCATATTCAGACTTGATCTAATTAGGTGGTTACACAGCAGTTGAGTATACTGGAGGTCCAGTTATGCTATTCAGAAT
GGGTAGAAAAGATGCTGAAGATCATGATGAGCACACTCCAGAGGATAGACTTCCAGATGTCAGAGAAGGAAGCAGCAATATTCTTACTAAGATGCATAGAATGGGTTTCACAACATAAGA
ATTTGTTGCCTTGATGGGATCCCACACTCTTGGTTTCGCTCATCAAGATAGAACTGGCTTCCAAGGCAGATGGACTCAAAATCCCCATGTCTTCGATAACACTTACTATAAGGAAGTGCT
ACTTGGAGAAAGATCTAAGTTCCTCAAGACTCCTGTAGAGCACATGCTTGCTCAAAATTCTGAGATGAAGAAACTTTGCGAGGCTTATGCCTAAGATTAAAATCTATTCTTTGAGCACTA
CGCCCTAGCTCATGTTAAGATGAGTGAACTCGGCCAAGAGGAACATTTACTCAGTGAATTTGAAGAGAATCAACCAAAATACAAGCTACCAGAGAGCTCATACCTCTAGCTAAATTCTTT
CTCTGACCCACAAAAATATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATATTAATCACATCGCAAAGAAGCCATTCTTTGATTTATTCTATAGATCACCATGCATGGCTCTTATGCTCAGAGCAGCCTTCCATGATGCTGGTACTTTCTGTAAAAACTCAAAA
ACTGG
GGGACCTAGAGGTACTTTAAGACATAGTCACGATTTGGATAGACCTGAAAACGCTGGACTTGATTTTGCGATGGACTAAATTGAGGAAATCAAGGATGAAGGAAACCATATCACT
GCTATGCTTTCATATTCAGACTTGATCTAATTAGGTGGTTACACAGCAGTTGAGTATACTGGAGGTCCAGTTATGCTATTCAGAATGGGTAGAAAAGATGCTGAAGATCATGATGAGCAC
ACTCCAGAGGATAGACTTCCAGATGTCAGAGAAGGAAGCAGCAATATTCTTACTAAGATGCATAGAATGGGTTTCACAACATAAGAATTTGTTGCCTTGATGGGATCCCACACTCTTGGT
TTCGCTCATCAAGATAGAACTGGCTTCCAAGGCAGATGGACTCAAAATCCCCATGTCTTCGATAACACTTACTATAAGGAAGTGCTACTTGGAGAAAGATCTAAGTTCCTCAAGACTCCT
GTAGAGCACATGCTTGCTCAAAATTCTGAGATGAAGAAACTTTGCGAGGCTTATGCCTAAGATTAAAATCTATTCTTTGAGCACTACGCCCTAGCTCATGTTAAGATGAGTGAACTCGGC
CAAGAGGAACATTTACTCAGTGAATTTGAAGAGAATCAACCAAAATACAAGCTACCAGAGAGCTCATACCTCTAGCTAAATTCTTTCTCTGACCCACAAAAATATTGA

Retrieve as FASTA