Entry information : CowCcP01
Entry ID 13539
Creation 2016-02-29 (Mbadinga)
Last sequence changes 2016-02-29 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-10 (Christophe Dunand)
Peroxidase information: CowCcP01
Name CowCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Ichthyosporea Capsaspora
Organism Capsaspora owczarzaki    [TaxId: 192875 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CowCcP01
start..stop
S start..stop
SsteCcP01 360 5e-124 67..348 75..352
WmikCcP01 356 2e-122 9..357 1..349
CatmCcP01_UTEX2591 355 3e-122 1..349 1..334
CatmCcP01_M2923 350 1e-120 81..349 71..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58..112 55 N° 2 1001..1310 310 N° 3 1441..2149 709  
join(58..112,1001..1310,1441..2149)


exon

Literature and cross-references CowCcP01
mRNA ref. GenBank:   XM_011272094
Cluster/Prediction ref. Genebank:   23302163
Protein sequence: CowCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358
PWM (Da):   %s   38834.47  
PI (pH):   %s   9.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSARLIRVVATAALPLRTGAVRTASNAAAVVAVQQQRSYSHGQGQGRSSNGKSSKFATGAATAFAAATTTGLMLVVSASEKTSKKGDYAAVRKDIADILDDSNYDDGSYGPAFVRLAWHASGSYSTFDKTGGSNGATMRFSPEAKYGANNGLERARARLEQVKQKHPWITYADLWTLAAVVAIEEMGGPKVPWHGGRVDDADNKRTAPDGRLPDAARGADHVRAIFYRMGFNDQEIVALIGAHVIGRAHDGKSANGSGYSGPWTFNPTTFNNGFYTTLLNTKWTEKKWNGPKQYTDPTGELMMLPADLAFLQDADLRKWVEVYAKDEKKFFEDFSAAFSKLLHLGVPAKTSCWWWPF

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCTCGTCTGATTCGCGTCGTCGCCACTGCCGCGCTTCCTCTTCGCACTGGTGCGTGTTTTGTGTGTCTCTTCTCATTCTCATCTCATCTCTTCTCTTCTCATCTCATCTCTCGT
TCTTCTGGTCCTGATTCTCCACACTTTTTGCTTCCCTTTTCTGTCAAAATCGTACGATTTGAATTGTTCAGTGATGACGCGCTTTTTCCCATCTCTCTCTCTCTCTCTCTCTCTCGCACA
GCACACTCGTTGTCGTCGCGTTGTTTGCGTTCTGCGTATGTGTGCGTGCGTGTGTGTATCTCGAGGTGGGGGGTGGTGGAACAGGACGAATGCATCCAGATCACATTCAAAATCAAAAGA
AGCGCTGTCCCTGCACAGTCTGACACCCCAATCGCCAATCGACCGTTCGCGCTCTGTCGGGTCGTGATTTTGTTTTGCTTGCTTGTTCTTGTTCGTTGGTGTGTTCGTTTCTCAAGCTTT
GCATTCGGAACCGTGTCATCGCAGCTGCAAAACGGATTTCAAAGAACGAAAAAAAAAAAATCAAATTGTTTTTGGAGTTTTTCAACTTCCGCTTCTTCTTCTTCCGTTCAAATGCGATTC
GATTCATAGGCGATCGTCGTCCATCGTCACCGTGAGCCGCACTCCGATCTGCACTCACTTCTCGCACGTGCCTTTTCCGTTTCCTTGCTATTTGTCCGCTTCTTCGCTTCTCCAAAAAGA
AAAAAAGAAAAAAAAAAGAAGAAAAAAAGCGAAAAGTTAAAAAATTCGCCGTTTCGATGTTGTTTTATTTTATTATTTTATTATTTATTTTTTCTTTTTTCTTGTTGATGATCAACAATT
TTGATCCTTTTTTTTTTTCTTTCTTTCATTCTGAGAAATTCAGCATTTTCACTCACCAACGCGTCGAATTTGTCAACATTGTTGTTTGTTTATTTATTTGCAGGTGCCGTGCGCACTGCC
TCCAATGCCGCCGCGGTGGTCGCTGTCCAGCAGCAGCGCAGCTACAGCCACGGCCAGGGCCAAGGTCGCTCGAGCAACGGCAAGAGCTCAAAGTTTGCCACGGGTGCTGCGACTGCGTTT
GCTGCTGCCACGACGACCGGCCTGATGTTGGTTGTCTCGGCGTCCGAGAAGACCTCCAAGAAGGGCGACTATGCTGCCGTTCGCAAGGACATTGCCGACATTCTCGATGATTCCAACTAC
GACGATGGCTCGTATGGACCTGCTTTCGTCCGTCTCGCCTGGCACGCATCTGG
GTAAGCCATTTGTTTGTTTGTTTGTTTGTTTTTGTTTGTTTTTGTTTTGTTTGTTTGTTTGTTTTTT
TCAACCTGCATGCTTGACACTCTTACTCACCCTCATTCACATGCTCACGCGCGCCAAATACAGCTCGTACAGCACGTTCGACAAGACTGGCGGCTCGAACGGCGCGACCATGCGCTTCTC
GCCCGAAGCCAAGTATGGCGCCAACAACGGCCTGGAGCGCGCTCGTGCTCGCCTTGAGCAGGTCAAGCAGAAGCACCCCTGGATTACATACGCCGATCTCTGGACTCTTGCTGCCGTGGT
TGCCATCGAGGAGATGGGCGGCCCCAAGGTTCCGTGGCACGGCGGCCGCGTTGACGACGCCGACAACAAGCGCACCGCTCCCGACGGTCGCCTGCCCGACGCTGCTCGTGGTGCCGACCA
CGTCCGTGCCATCTTCTACCGCATGGGCTTCAACGACCAGGAAATTGTCGCCCTGATTGGCGCGCACGTCATTGGCCGCGCGCACGACGGCAAGTCCGCCAACGGCTCGGGCTACTCTGG
TCCGTGGACGTTCAACCCGACCACGTTCAACAATGGTTTCTACACGACGCTCCTCAACACCAAGTGGACGGAAAAGAAGTGGAACGGTCCCAAGCAGTACACGGATCCCACTGGCGAGCT
CATGATGCTCCCTGCCGATCTCGCCTTCCTCCAGGACGCCGACTTGCGAAAGTGGGTCGAGGTCTACGCCAAGGACGAGAAGAAGTTCTTTGAGGACTTTTCCGCCGCCTTTTCAAAGCT
CCTCCACCTCGGCGTCCCTGCCAAGACCAGCTGCTGGTGGTGGCCCTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCTCGTCTGATTCGCGTCGTCGCCACTGCCGCGCTTCCTCTTCGCACTGGTGCCGTGCGCACTGCCTCCAATGCCGCCGCGGTGGTCGCTGTCCAGCAGCAGCGCAGCTACAGC
CACGGCCAGGGCCAAGGTCGCTCGAGCAACGGCAAGAGCTCAAAGTTTGCCACGGGTGCTGCGACTGCGTTTGCTGCTGCCACGACGACCGGCCTGATGTTGGTTGTCTCGGCGTCCGAG
AAGACCTCCAAGAAGGGCGACTATGCTGCCGTTCGCAAGGACATTGCCGACATTCTCGATGATTCCAACTACGACGATGGCTCGTATGGACCTGCTTTCGTCCGTCTCGCCTGGCACGCA
TCTGG
CTCGTACAGCACGTTCGACAAGACTGGCGGCTCGAACGGCGCGACCATGCGCTTCTCGCCCGAAGCCAAGTATGGCGCCAACAACGGCCTGGAGCGCGCTCGTGCTCGCCTTGAG
CAGGTCAAGCAGAAGCACCCCTGGATTACATACGCCGATCTCTGGACTCTTGCTGCCGTGGTTGCCATCGAGGAGATGGGCGGCCCCAAGGTTCCGTGGCACGGCGGCCGCGTTGACGAC
GCCGACAACAAGCGCACCGCTCCCGACGGTCGCCTGCCCGACGCTGCTCGTGGTGCCGACCACGTCCGTGCCATCTTCTACCGCATGGGCTTCAACGACCAGGAAATTGTCGCCCTGATT
GGCGCGCACGTCATTGGCCGCGCGCACGACGGCAAGTCCGCCAACGGCTCGGGCTACTCTGGTCCGTGGACGTTCAACCCGACCACGTTCAACAATGGTTTCTACACGACGCTCCTCAAC
ACCAAGTGGACGGAAAAGAAGTGGAACGGTCCCAAGCAGTACACGGATCCCACTGGCGAGCTCATGATGCTCCCTGCCGATCTCGCCTTCCTCCAGGACGCCGACTTGCGAAAGTGGGTC
GAGGTCTACGCCAAGGACGAGAAGAAGTTCTTTGAGGACTTTTCCGCCGCCTTTTCAAAGCTCCTCCACCTCGGCGTCCCTGCCAAGACCAGCTGCTGGTGGTGGCCCTTCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTCAATCCG ACTTTCACTC CCTTTTTTTG TTGTTGCTGT TGTTCCAAAC AAAACCAATG TCTGCTCGTC TGATTCGCGT CGTCGCCACT GCCGCGCTTC CTCTTCGCAC TGGTGCCGTG  CGCACTGCCT CCAATGCCGC CGCGGTGGTC GCTGTCCAGC AGCAGCGCAG CTACAGCCAC GGCCAGGGCC AAGGTCGCTC GAGCAACGGC AAGAGCTCAA AGTTTGCCAC GGGTGCTGCG  ACTGCGTTTG CTGCTGCCAC GACGACCGGC CTGATGTTGG TTGTCTCGGC GTCCGAGAAG ACCTCCAAGA AGGGCGACTA TGCTGCCGTT CGCAAGGACA TTGCCGACAT TCTCGATGAT  TCCAACTACG ACGATGGCTC GTATGGACCT GCTTTCGTCC GTCTCGCCTG GCACGCATCT GGCTCGTACA GCACGTTCGA CAAGACTGGC GGCTCGAACG GCGCGACCAT GCGCTTCTCG  CCCGAAGCCA AGTATGGCGC CAACAACGGC CTGGAGCGCG CTCGTGCTCG CCTTGAGCAG GTCAAGCAGA AGCACCCCTG GATTACATAC GCCGATCTCT GGACTCTTGC TGCCGTGGTT  GCCATCGAGG AGATGGGCGG CCCCAAGGTT CCGTGGCACG GCGGCCGCGT TGACGACGCC GACAACAAGC GCACCGCTCC CGACGGTCGC CTGCCCGACG CTGCTCGTGG TGCCGACCAC  GTCCGTGCCA TCTTCTACCG CATGGGCTTC AACGACCAGG AAATTGTCGC CCTGATTGGC GCGCACGTCA TTGGCCGCGC GCACGACGGC AAGTCCGCCA ACGGCTCGGG CTACTCTGGT  CCGTGGACGT TCAACCCGAC CACGTTCAAC AATGGTTTCT ACACGACGCT CCTCAACACC AAGTGGACGG AAAAGAAGTG GAACGGTCCC AAGCAGTACA CGGATCCCAC TGGCGAGCTC  ATGATGCTCC CTGCCGATCT CGCCTTCCTC CAGGACGCCG ACTTGCGAAA GTGGGTCGAG GTCTACGCCA AGGACGAGAA GAAGTTCTTT GAGGACTTTT CCGCCGCCTT TTCAAAGCTC  CTCCACCTCG GCGTCCCTGC CAAGACCAGC TGCTGGTGGT GGCCCTTCTA AACCGGGTTG GGTTTCTCAA CCCAGCCGGG ATTGGGTGTT TGTCTGAGCC TTTTTTGGTT TTTTGTTGGA 
GCTCTGTCCT GTAGGTTGGA TGCTTGTGTT GCGTTGCAAT ATACAGTACA ATACCCA 

Retrieve as FASTA