Entry information : HaPrx26 (HanXRQChr16g0530751)
Entry ID 13557
Creation 2016-04-27 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx26 (HanXRQChr16g0530751)
Name (synonym) HaPrx26 (HanXRQChr16g0530751)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx26
start..stop
S start..stop
HaPrx27 612 0 1..325 1..324
LsaPrx08 590 0 1..326 1..325
RcPrx17 546 0 8..326 5..331
EglPrx137 546 0 2..325 3..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 177662840..177663049 210 N° 2 177661657..177661848 192 N° 3 177661410..177661575 166 N° 4 177660260..177660672 413
complement(join(177660260..177660672,177661410..177661575,177661657..177661848,1 77662840..177663049))


exon

Literature and cross-references HaPrx26 (HanXRQChr16g0530751)
DNA ref. HanXRQ genome:   HanXRQChr16 (177663049..177660260)
Protein sequence: HaPrx26 (HanXRQChr16g0530751)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (304)
PWM (Da):   %s   35650.15 (33302.9) Transmb domain:   %s   i5-27o
PI (pH):   %s   9.39 (9.22) Peptide Signal:   %s   cut: 23 range:23-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARSSITMLMFLIISILAIANGSYLYPQFYDHSCPQAKDIVQSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASILLDNSGSIISEKGSVPNRNSARGFEVIDQIKAALEEACPQTVSCADIMALAARDSTVLTGGPSWEVPLGRRDSLGASLSGSNQNIPAPNNTFQTILTKFKLKGLDIVDFVALSGSHTIGNARCTSFRQRLYNNTGNGRPDFSLDQSYAAKLRQNCPRSGGDQNLFFLDPVSPTKFDNNYYKNLIAKKGLLSSDEILFTQNQQTMEFVKQYAANQELFFQQFAKSMVKMGNIAPLTGKSGQIRKICRKINS

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGGTCGTCAATCACCATGCTCATGTTTCTGATCATCTCTATCCTGGCTATAGCCAATGGCTCTTACCTCTACCCTCAGTTTTACGACCACTCATGTCCGCAAGCTAAAGACATA
GTCCAGTCTGTCGTTGCGAAAGCTGTTGCAAAAGAGGCTCGTATGGCTGCTTCTTTGCTCAGACTCCATTTCCACGATTGTTTTGTCAAG
GTTTGTTCTTAATAAGTATCGTCACTACTA
AACTCTGCTATTGTTATGGACAAATTAAATATCAACTTGTCACAAGTTTTAGGTGTCACCACTCACCATATATCTACTTACACCGAAAGTTACCCGAATTTTTCCTTTTGGGCTTTAATA
TTTGTAAAACGAAGTTTAATTAATTCTATGTTTTTAAACATTTAAAAAATATAAATTTTAATAATCTAAATTTGTAATTATATATATATTACTTTAAGATTTTATTATAATGTCTAGGAC
GCAATATTTTTGCGCTGGTATGACGCAAGCAGAAATCGTGTCATTGTTTTAGTGCACATAAATCTAGATAAATATGAAAGTCAAATGGCTATTTTTGTTAAAGGGAATATGTCACAGAAT
AGTAACCAAGTTTCAAAAGTGTTTTAATTAGGTCACTCGTATCGTTTTTATCCCATTTAGATAACTTAACATTCAAATCGAGTCATGCCCTTTTTTCTATGTGTCAAGAAAAAAATGAAG
AATAAGATGTTGGGGTCGGATTATTTTAATATATGAAATTATATTTATTAAAAATAAAAAACTTTAATTACATTAAAAATTAAAAAAAAAACAAGTTACAATTCACGTTATCATTCAAAG
TTAGCATCAAATAAAAGGGAAAAGAGAAACAAAAATCCACATCACCATGGTTACTTATGAAATGGATGAAAAAACCCTTAATTTTAATGAAAAATGAATGTTGAGTGACCTGATTGAAAC
ACTTTTGAAACTTGAGTGACCTAATTGGAACACTTTTAAAACTTGGTTACTATTCTACAAAGTTACCCCTTTGTTAAACGTATTGGTCAAGTGGCTCTATAAATTGGTAAAATATTTATA
TAAACATGAAAGTCAAATAGCTATTTTTGTGAAACGTATTGATTAAATGGTTCTAAAAGTTAGTAAAATGTTGTTATGGTGATCAGAAACTTACTCTATGTGCATTCAAATAATCATTTA
GGGGTGCGATGCTTCGATACTTCTTGACAACAGTGGAAGCATAATCAGCGAGAAGGGGTCCGTCCCAAACCGCAACTCGGCTCGTGGGTTCGAAGTCATTGACCAAATCAAAGCTGCATT
GGAGGAGGCGTGCCCTCAAACCGTCTCGTGTGCTGATATTATGGCTCTAGCAGCTAGAGACTCTACCGTTCTG
GTATCATATCCTAACACACCCATGGCACATAACTTATTATTTGAACC
TTAAATCATGAATGCATGTTTTAAATTTGTGCAGACTGGTGGACCAAGTTGGGAAGTCCCATTAGGCAGAAGGGATTCATTAGGTGCAAGCTTGAGTGGTTCTAACCAAAACATTCCTGC
TCCCAACAACACTTTTCAGACCATTCTCACCAAATTCAAGCTTAAGGGTCTTGACATTGTTGATTTTGTAGCACTATCAG
GTAAGATTTAAACATGGTTGATTAAAAAAGGCTAATATCT
AAAAAAAGAAAATTGGTATTTAATAAACCAACCTTTAACCAGTTGGTAAATAATAATCCAACCTTCAAAATTGGTAAATAATAATCTCACCTATCAACATGTTGGTACTCAATGAACTTT
CGTTAATTTTTTTTAACTGAAGTTAGTTTTTATGTTTTATTTATTACACAAACAGTCCCTGTAGTTGTAATTTACTAGTTTTAACTATTTTATGAAACAAAAAAACCACTCGAAAATCCT
CCTTTTCCTCGATTTGAGGTTTATAAAATAGTTAAAACTAGTAAATTACAACTACATGGACTGTTTGTGTAATAAATAAAACTTAAAAACTAACTTCAGTTAAAAAAAATTAACGGAAGT
TCATTGAGTACCAACATGTTGATAGGTAGGATTATTATATACCAATTCTGTAGGTTGGATTATTATTTACCAACTGGTTAAAGGTTGGTTTATTAAATACCAATTTTCCCTAAAAAAAAG
TTAAATAGTGTAACACTTTTAAGTTTTTAAATATTTTAAAACAATTAATAAAGATTGAAAGTTAAGTTTTTAAATATGCATGGTTTTTAATAATAAACTACTTATTTTTTTATTTTTCTT
TAATTTTGTCATGTTAATATTCAAGAAAATTTTGAAAAATCTATTATAGTTCAAGAAAAATGATAATCTCTTGGTCTTAAAACATTTCTCTTTGCAGGAAGTCACACTATTGGAAATGCT
AGGTGTACCAGTTTCAGGCAAAGGTTATACAACAACACCGGCAACGGGCGGCCCGACTTTTCGCTAGACCAATCATACGCCGCGAAGCTTCGCCAAAACTGTCCAAGATCCGGTGGTGAT
CAGAACCTGTTTTTCTTGGATCCGGTGTCACCCACAAAATTCGATAACAATTATTACAAGAACTTAATTGCTAAAAAGGGTCTTCTAAGCTCTGATGAAATACTTTTTACTCAAAACCAA
CAAACAATGGAGTTTGTGAAGCAGTATGCTGCAAATCAAGAGCTTTTCTTCCAGCAGTTTGCAAAGTCTATGGTTAAAATGGGAAACATTGCTCCTTTGACCGGCAAAAGTGGTCAAATC
AGAAAGATTTGCAGAAAAATCAATAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGGTCGTCAATCACCATGCTCATGTTTCTGATCATCTCTATCCTGGCTATAGCCAATGGCTCTTACCTCTACCCTCAGTTTTACGACCACTCATGTCCGCAAGCTAAAGACATA
GTCCAGTCTGTCGTTGCGAAAGCTGTTGCAAAAGAGGCTCGTATGGCTGCTTCTTTGCTCAGACTCCATTTCCACGATTGTTTTGTCAAG
GGGTGCGATGCTTCGATACTTCTTGACAAC
AGTGGAAGCATAATCAGCGAGAAGGGGTCCGTCCCAAACCGCAACTCGGCTCGTGGGTTCGAAGTCATTGACCAAATCAAAGCTGCATTGGAGGAGGCGTGCCCTCAAACCGTCTCGTGT
GCTGATATTATGGCTCTAGCAGCTAGAGACTCTACCGTTCTG
ACTGGTGGACCAAGTTGGGAAGTCCCATTAGGCAGAAGGGATTCATTAGGTGCAAGCTTGAGTGGTTCTAACCAAAAC
ATTCCTGCTCCCAACAACACTTTTCAGACCATTCTCACCAAATTCAAGCTTAAGGGTCTTGACATTGTTGATTTTGTAGCACTATCAG
GAAGTCACACTATTGGAAATGCTAGGTGTACC
AGTTTCAGGCAAAGGTTATACAACAACACCGGCAACGGGCGGCCCGACTTTTCGCTAGACCAATCATACGCCGCGAAGCTTCGCCAAAACTGTCCAAGATCCGGTGGTGATCAGAACCTG
TTTTTCTTGGATCCGGTGTCACCCACAAAATTCGATAACAATTATTACAAGAACTTAATTGCTAAAAAGGGTCTTCTAAGCTCTGATGAAATACTTTTTACTCAAAACCAACAAACAATG
GAGTTTGTGAAGCAGTATGCTGCAAATCAAGAGCTTTTCTTCCAGCAGTTTGCAAAGTCTATGGTTAAAATGGGAAACATTGCTCCTTTGACCGGCAAAAGTGGTCAAATCAGAAAGATT
TGCAGAAAAATCAATAGTTAA

Retrieve as FASTA