Entry information : HaPrx24 (HanXRQChr02g0054351)
Entry ID 13558
Creation 2016-04-27 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx24 (HanXRQChr02g0054351)
Name (synonym) HaPrx24 (HanXRQChr02g0054351)
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx24
start..stop
S start..stop
HaPrx24_Rodeo 469 3e-169 65..304 1..240
EguPrx62 447 6e-159 6..330 9..331
EcamPrx62 444 3e-158 6..333 9..334
LsaPrx42 441 1e-157 1..286 1..287
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 161136378..161136599 222 N° 2 161135569..161135748 180 N° 3 161135309..161135471 163 N° 4 161134536..161134975 440
complement(join(161134536..161134975,161135309..161135471,161135569..161135748,1 61136378..161136599))


exon

Literature and cross-references HaPrx24 (HanXRQChr02g0054351)
DNA ref. HanXRQ genome:   HanXRQChr02 (161136599..161134536)
Cluster/Prediction ref. HanXRQ:   HanXRQChr02g0054351
Protein sequence: HaPrx24 (HanXRQChr02g0054351)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (309)
PWM (Da):   %s   36220.67 (33615.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.56 (9.59) Peptide Signal:   %s   cut: 26 range:26-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTNSKAVALAVGFMILLNLTGHCYGALEFGFYNGKCKLSDVEDIVRRTVYSKFLKDRTIAPALIRMQFHDCFVNGCDASILLDGPNAEKTAPPNLSVRGYNVIDDAKAAVEKVCPEVVSCADIIVMATRDVISFSGGRRYSVQTGRRDGRVSLARNTQTLPPPSASVSSAIRAFARKGLNPTDMLYLLGGHTIGIAHCSLFQDRLYNFQNSGKPDPTMDATLIASLRKTCAQNATLDRTVNLDQNPLSSKVIDKSFYNQIMLRRGILQIDQQLALDGLTKSKVAAIAASSDFNTKFGQAMVKMGAIQVLTGTQGEIRKSCRAINPQNMIPIINI

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAAACAGTAAAGCAGTTGCATTAGCAGTTGGGTTCATGATCTTGTTGAACCTCACTGGTCACTGCTATGGTGCCCTCGAGTTCGGGTTCTATAATGGCAAGTGCAAATTGTCAGAT
GTTGAAGACATTGTAAGACGAACTGTCTACTCCAAGTTCCTTAAGGACCGAACGATTGCCCCTGCTCTCATTCGTATGCAGTTTCACGACTGTTTTGTTAAT
GTAAGTTTCTTCCATTTT
CATGCATGAAGCCATAGTCATAATTTTTATAATTTTACATGCGTTCACATTTCTGAAAACTTGATTACTTCCGGCAGATTTGCTACTGAAATTTACTTTATTTTTTTTCCGCTATATATT
TCGCGACCACCTTACCCTATATGTTTCGCAACCACCTTACGACAAGAATTTTAATTTTAATTTTAATTTCAAAATGATTTTTTTTTTCAATTTTGTGAGCGGTATTTATGCTTTTTAATT
TGAAATTCATATTATGCGATGGTTTTGCGACTGTAGCAACCTGGCCGCAAATGTTTTGTAACCGATATTTAGATTTTAATTTTAGGTTATTATTTCTTCATTATTTGTGAACGCCCTCAA
AAGGTCACAACTTTTGTGACCGTATTGCTTTCTTATTTTTATTATAATTATATTTATATTTCATATGTTTGTGAGGTATATATAATTAGATTTTATTTAGTTATTCCACAACTTTTGTGA
CAGAAAATTAGCGCTCGTAAATTCTCGATGGTCACTAATTTTGTGGTCGTAAACTGGTCCCTAACTTTGCGACCATTTTTGCAAATACTCACCTTTTTTGGTAGTAATTTTAACTTTGTA
TGTTTTGAAAGGGGTGTGATGCATCGATTCTACTAGATGGACCCAACGCAGAGAAAACTGCACCACCAAATTTAAGTGTTAGAGGTTACAATGTCATTGATGATGCAAAAGCCGCGGTGG
AGAAGGTGTGCCCAGAAGTTGTTTCTTGCGCGGATATAATCGTGATGGCTACAAGAGATGTCATTTCCTTT
GTAAGTACTAATAAATGCACCAGATCCCATAAAAACTCGAAGCTAACTT
TATTTTTGCATTATTTAACTTGTAAAATAATGCTAAATAATTATACAGAGTGGTGGACGTAGATATAGTGTTCAAACAGGAAGAAGGGATGGACGTGTGTCTCTTGCCCGAAATACACAA
ACCCTCCCACCTCCTTCTGCATCGGTGTCAAGTGCAATTCGAGCTTTTGCTCGCAAAGGACTCAACCCAACTGACATGCTCTATCTTCTTG
GTAATTTAGCAAGTTTTGTTCATACCATT
TATAGTTACCGCCACCAGAAAAATATTTGATTTTAGACGACTCATGAAAAATTTAAATACTTTCCACACATTTAGGACATGTCGTCTCAACCCTAAAGGGGATCCTATGATCGGGACCCT
TTTCATAAAACAGAAATATATATATTTTTTGCTTAATATCCAAACACATGAGAATATCATGATGTGTACTTCTAAGTTCTAAGTTTAGAATGAACTTGTTGTGTCATAAATTGGTGTGTA
AATTGGATTTATTTTATGGCACGCATAAAACTTAGTTTAACGTGTGCATATTTTAATTGTCTAGGTGGGCACACTATCGGAATCGCTCATTGTTCTTTATTTCAAGATCGTCTTTACAAC
TTTCAGAACTCGGGTAAACCAGACCCGACAATGGATGCAACGCTGATAGCCTCACTAAGGAAGACATGTGCTCAAAACGCAACACTTGATCGCACTGTGAACTTGGATCAAAACCCTTTA
AGCTCTAAAGTGATAGACAAATCATTTTACAATCAAATTATGTTGCGTAGAGGAATTCTTCAGATTGATCAACAATTGGCATTGGACGGTTTAACCAAGTCCAAGGTTGCAGCCATTGCT
GCTTCGTCTGATTTCAACACTAAGTTTGGTCAAGCCATGGTTAAGATGGGTGCGATCCAAGTTCTCACAGGAACACAAGGGGAGATAAGGAAATCATGCCGAGCAATCAACCCACAAAAT
ATGATTCCTATTATAAATATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAAACAGTAAAGCAGTTGCATTAGCAGTTGGGTTCATGATCTTGTTGAACCTCACTGGTCACTGCTATGGTGCCCTCGAGTTCGGGTTCTATAATGGCAAGTGCAAATTGTCAGAT
GTTGAAGACATTGTAAGACGAACTGTCTACTCCAAGTTCCTTAAGGACCGAACGATTGCCCCTGCTCTCATTCGTATGCAGTTTCACGACTGTTTTGTTAAT
GGGTGTGATGCATCGATT
CTACTAGATGGACCCAACGCAGAGAAAACTGCACCACCAAATTTAAGTGTTAGAGGTTACAATGTCATTGATGATGCAAAAGCCGCGGTGGAGAAGGTGTGCCCAGAAGTTGTTTCTTGC
GCGGATATAATCGTGATGGCTACAAGAGATGTCATTTCCTTT
AGTGGTGGACGTAGATATAGTGTTCAAACAGGAAGAAGGGATGGACGTGTGTCTCTTGCCCGAAATACACAAACCCTC
CCACCTCCTTCTGCATCGGTGTCAAGTGCAATTCGAGCTTTTGCTCGCAAAGGACTCAACCCAACTGACATGCTCTATCTTCTTG
GTGGGCACACTATCGGAATCGCTCATTGTTCTTTA
TTTCAAGATCGTCTTTACAACTTTCAGAACTCGGGTAAACCAGACCCGACAATGGATGCAACGCTGATAGCCTCACTAAGGAAGACATGTGCTCAAAACGCAACACTTGATCGCACTGTG
AACTTGGATCAAAACCCTTTAAGCTCTAAAGTGATAGACAAATCATTTTACAATCAAATTATGTTGCGTAGAGGAATTCTTCAGATTGATCAACAATTGGCATTGGACGGTTTAACCAAG
TCCAAGGTTGCAGCCATTGCTGCTTCGTCTGATTTCAACACTAAGTTTGGTCAAGCCATGGTTAAGATGGGTGCGATCCAAGTTCTCACAGGAACACAAGGGGAGATAAGGAAATCATGC
CGAGCAATCAACCCACAAAATATGATTCCTATTATAAATATTTGA

Retrieve as FASTA