Entry information : HaPrx01 (HanXRQChr17g0561161)
Entry ID 13560
Creation 2016-04-27 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx01 (HanXRQChr17g0561161)
Name (synonym) HaPrx01 (HanXRQChr17g0561161)
Class Class III peroxidase    [Orthogroup: Prx103]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx01
start..stop
S start..stop
HaPrx01_QIR8 637 0 1..320 1..320
HarPrx20 637 0 1..320 1..320
ZePrx14 483 8e-174 1..316 1..317
ZePrx15 481 3e-173 1..316 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 157435107..157435328 222 N° 2 157435424..157435603 180 N° 3 157435674..157435839 166 N° 4 157436333..157436727 395
join(157435107..157435328,157435424..157435603,157435674..157435839,157436333..1 57436727)


exon

Literature and cross-references HaPrx01 (HanXRQChr17g0561161)
DNA ref. HanXRQ genome:   HanXRQChr17 (157435107..157436727)
Cluster/Prediction ref. HanXRQ:   HanXRQChr17g0561161
Protein sequence: HaPrx01 (HanXRQChr17g0561161)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320
PWM (Da):   %s   33697.64 Transmb domain:   %s   i7-24o
PI (pH):   %s   4.47
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGYYKSTILVTIFIILISADYFMPCKAQLSTTFYDTTCPNALSTIQTSINAAVSRNGRNAASVIRLHFHDCFVQGCDASLLLGGAGSEKESAANDGVVGYDVIDDAKAAVESVCPGVVSCADILAVAARDASVAVGGPSWTVRLGRRDSPDSNAAEAATDLPRGNMNLGELISNFANKGFNTREMVALSGSHTLGQARCLRFRGRIYNSPLPIDAAFNTSLTAICPPTPPTGDETLQPLDLVTPNAFDNNYFLNLRASRGLLISDQVLFNGDSADSIVTEYADNPATFDSDFAAAMVKMSEIEVLTGTSGIIRTVCTSAT

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTATTATAAGTCTACTATCTTGGTCACTATATTTATTATACTTATATCAGCAGACTACTTCATGCCATGCAAAGCTCAGTTGTCAACCACCTTTTATGATACCACATGCCCTAAT
GCACTTTCAACCATTCAAACTTCAATTAATGCTGCGGTATCACGTAATGGTCGCAATGCAGCCTCCGTTATTCGCCTTCATTTTCATGATTGTTTCGTTCAG
GTTATGATCTTTTTTCCA
TTCCATGATGCTTTTTTTGATGATTTGACATAAGAACATGCAGTTTTAAATTATTAACCTGGTAAATAATTTTACAGGGTTGTGATGCATCTCTTTTGCTAGGAGGTGCTGGCAGTGAGA
AGGAGTCAGCAGCCAATGATGGTGTGGTGGGCTACGATGTTATAGATGATGCTAAAGCTGCAGTCGAGAGCGTATGTCCTGGAGTTGTATCGTGTGCTGATATACTTGCGGTCGCAGCTC
GTGATGCTTCTGTCGCG
GTAATAATAAAATTAAATTAATTATATGTAAAACATAGGTTCATAAATTTATGATTATTTCACTGTGTAGGTTGGGGGGCCGTCATGGACCGTAAGACTTGGA
AGAAGAGATTCACCAGATTCAAACGCGGCAGAAGCCGCAACTGATCTTCCAAGAGGGAATATGAATTTAGGTGAACTTATCAGCAACTTTGCTAATAAGGGATTTAACACGAGAGAAATG
GTCGCCTTATCAG
GTTAGAACTCTTTCTGTTTAATTCCTTGATAGCATATAACGGATTTTTGTTTGTTTTTTTTTTTTTTTTTTTTTTTGTTAAAATATGACTTTAATTGCATTGATAAA
AAAGCAAAGGCGATATATATTTGTGACCAATACAAAAGAAAACCGGTCTGATACGACAGCCTGTCCTGACGATATTTCTTCGGGATAGTCTTTACCAAAGGATTTTTATGTAGTGACAAA
CAATTGCAAATTAACAACCACAAGTCACAACAAAATTGCTGCAAAGCTAGCTACCGAAATGGTTCAGCCCAGTGGTTTAATTAAGTTGCAAAAGTATGTCATGCAGAAAATAGTTGCTAC
CAGGGTTTAATTAAGCGACCGCAAAAACCATTCAATATGGTGCAAAATGGCATTTGTGACCAAAAAGGTCGTAAAGATCGTTTTTTATAAGTAGTAATCGTTGGTGACACAAGTAAATAA
CATGTACAATAATTGTTGTTTTGCAGGATCTCATACACTCGGGCAGGCCAGATGTCTTAGGTTTAGGGGAAGGATATACAACAGTCCTCTACCTATTGATGCTGCTTTTAATACCTCCCT
TACTGCAATCTGCCCACCGACTCCACCTACTGGCGATGAGACCTTGCAACCACTTGATTTAGTGACACCAAACGCATTCGACAACAACTACTTCCTGAATCTTCGGGCTAGTAGGGGTCT
TCTTATATCAGACCAAGTACTCTTTAACGGAGACTCAGCTGATAGCATTGTGACCGAGTACGCTGACAATCCTGCAACGTTTGATTCTGATTTTGCTGCAGCCATGGTTAAGATGAGTGA
AATTGAAGTCCTTACCGGTACCAGTGGGATTATAAGGACTGTTTGCACTAGTGCAACTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTATTATAAGTCTACTATCTTGGTCACTATATTTATTATACTTATATCAGCAGACTACTTCATGCCATGCAAAGCTCAGTTGTCAACCACCTTTTATGATACCACATGCCCTAAT
GCACTTTCAACCATTCAAACTTCAATTAATGCTGCGGTATCACGTAATGGTCGCAATGCAGCCTCCGTTATTCGCCTTCATTTTCATGATTGTTTCGTTCAG
GGTTGTGATGCATCTCTT
TTGCTAGGAGGTGCTGGCAGTGAGAAGGAGTCAGCAGCCAATGATGGTGTGGTGGGCTACGATGTTATAGATGATGCTAAAGCTGCAGTCGAGAGCGTATGTCCTGGAGTTGTATCGTGT
GCTGATATACTTGCGGTCGCAGCTCGTGATGCTTCTGTCGCG
GTTGGGGGGCCGTCATGGACCGTAAGACTTGGAAGAAGAGATTCACCAGATTCAAACGCGGCAGAAGCCGCAACTGAT
CTTCCAAGAGGGAATATGAATTTAGGTGAACTTATCAGCAACTTTGCTAATAAGGGATTTAACACGAGAGAAATGGTCGCCTTATCAG
GATCTCATACACTCGGGCAGGCCAGATGTCTT
AGGTTTAGGGGAAGGATATACAACAGTCCTCTACCTATTGATGCTGCTTTTAATACCTCCCTTACTGCAATCTGCCCACCGACTCCACCTACTGGCGATGAGACCTTGCAACCACTTGAT
TTAGTGACACCAAACGCATTCGACAACAACTACTTCCTGAATCTTCGGGCTAGTAGGGGTCTTCTTATATCAGACCAAGTACTCTTTAACGGAGACTCAGCTGATAGCATTGTGACCGAG
TACGCTGACAATCCTGCAACGTTTGATTCTGATTTTGCTGCAGCCATGGTTAAGATGAGTGAAATTGAAGTCCTTACCGGTACCAGTGGGATTATAAGGACTGTTTGCACTAGTGCAACT
TAA

Retrieve as FASTA