Entry information : HaPrx[P]125 (HanXRQChr17g0551281)
Entry ID 13586
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2017-12-08 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-12-08 (Christophe Dunand)
Peroxidase information: HaPrx[P]125 (HanXRQChr17g0551281)
Name (synonym) HaPrx[P]125 (HanXRQChr17g0551281)
Class Class III peroxidase     [Orthogroup: Prx040]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx[P]125
start..stop
S start..stop
HaPrx133 355 9e-124 1..187 260..448
HaPrx[P]135 345 1e-123 11..187 1..177
HaPrx[P]134 329 3e-117 11..187 1..172
SsqPrx01_A34-4-23 234 9e-78 1..187 122..310
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 71308735..71308764 30 N° 2 71308843..71309005 163 N° 3 71309121..71309488 368  
join(71308735..71308764,71308843..71309005,71309121..71309488)


exon

Literature and cross-references HaPrx[P]125 (HanXRQChr17g0551281)
DNA ref. HanXRQ genome:   HanXRQChr17 (71308735..71309488)
Protein sequence: HaPrx[P]125 (HanXRQChr17g0551281)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   186
PWM (Da):   %s   20046.88  
PI (pH):   %s   7.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLGVASRYHGTGGSGWAVPTGRRDGLVSLASDAESIPGPKDSIDDQIKKFANKGLSIEDLVTLVGGHTIGTAGCVTFSDRLYN*NNTNAPDPAIDQGFLPHLQTLCPLSGDLTRRVALDTNSENNFDNSFYENIRRGRGVLESDSKLWSDPRTQKFAQPFIGASRSHGSTFNKMFAIAMVKMCNYD

Retrieve as FASTA  
Remarks Pseudogene from genomic (only exons 3 and 4 with stop in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGGGTGTTGCATCTCGGTATCATGGTGTACATGAAAGTTTTGCCCTCATTAATTCCTTGCTATGAGTAGAATCTTACTGAGTACGTTTATTTATATTGTTTTAGACTGGGGGAAGT
GGTTGGGCAGTGCCAACAGGTCGTCGAGACGGATTAGTTTCACTGGCATCTGATGCAGAAAGCATACCTGGTCCTAAAGACTCCATTGATGACCAAATCAAGAAGTTTGCTAACAAAGGT
CTTAGCATTGAAGATCTTGTTACCCTTGTAG
GTAAGTTAAGACTAAAAGCTAGAACAGTAGCCATAACGACAAATTAACATTGGAATGGATTTAGTTTCAAATGAACTAACTTGCATATT
CTGCGGTTTAATTCAATGATTATCAGGAGGACATACGATTGGGACAGCTGGCTGTGTCACATTCAGTGACAGGCTATACAACTAAAACAATACTAATGCACCCGACCCTGCTATTGACCA
AGGATTCCTTCCCCATCTTCAAACCCTATGTCCTCTTAGCGGTGATCTTACAAGGCGAGTGGCCTTGGATACAAACAGCGAAAACAATTTCGACAACTCATTCTATGAAAACATAAGGCG
TGGACGAGGAGTACTTGAATCCGATTCAAAGCTGTGGAGTGACCCACGAACACAAAAGTTTGCGCAACCGTTTATTGGAGCTAGCAGATCGCATGGATCGACATTCAACAAGATGTTCGC
GATAGCAATGGTGAAGATGTGCAATTATGATTTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGGGTGTTGCATCTCGGTATCATGGTACTGGGGGAAGTGGTTGGGCAGTGCCAACAGGTCGTCGAGACGGATTAGTTTCACTGGCATCTGATGCAGAAAGCATACCTGGTCCTAAA
GACTCCATTGATGACCAAATCAAGAAGTTTGCTAACAAAGGTCTTAGCATTGAAGATCTTGTTACCCTTGTAG
GAGGACATACGATTGGGACAGCTGGCTGTGTCACATTCAGTGACAGG
CTATACAACTAAAACAATACTAATGCACCCGACCCTGCTATTGACCAAGGATTCCTTCCCCATCTTCAAACCCTATGTCCTCTTAGCGGTGATCTTACAAGGCGAGTGGCCTTGGATACA
AACAGCGAAAACAATTTCGACAACTCATTCTATGAAAACATAAGGCGTGGACGAGGAGTACTTGAATCCGATTCAAAGCTGTGGAGTGACCCACGAACACAAAAGTTTGCGCAACCGTTT
ATTGGAGCTAGCAGATCGCATGGATCGACATTCAACAAGATGTTCGCGATAGCAATGGTGAAGATGTGCAATTATGATTTG

Retrieve as FASTA