Entry information : MmulGPx02
Entry ID 1359
Creation 2009-02-02 (Christophe Dunand)
Last sequence changes 2010-11-05 (Myriam Duval)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-11-05 (Myriam Duval)
Peroxidase information: MmulGPx02
Name MmulGPx02
Class Animal glutathione peroxidase    [Orthogroup: Gpx1004]
Taxonomy Eukaryota Metazoa Chordata Mammalia Cercopithecidae Macaca
Organism Macaca mulatta (rhesus monkey)    [TaxId: 9544 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MmulGPx02
start..stop
S start..stop
PtroGPx02 387 3e-140 1..190 1..190
HsGPx02 387 3e-140 1..190 1..190
HlGPx02 386 6e-140 1..190 1..190
MfGPx02 386 9e-140 1..190 1..190
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 127942262..127942483 222 N° 2 127939244..127939591 348  
complement(join(127939244..127939591,127942262..127942483))


exon

Literature and cross-references MmulGPx02
mRNA ref. GenBank:   NM_001115137
Cluster/Prediction ref. GenBank:   Mmu.7235 UniGene:   Mmu.7235
Protein sequence: MmulGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   190
PWM (Da):   %s   21579.05  
PI (pH):   %s   8.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFIAKSFYGVSAISLDGEKVDFNTFRGRAVLIENVASL*GTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPHDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo7, 1 intron) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCATTGCCAAGTCCTTCTATGGCGTCAGTGCCATCAGCCTGGATGGGGAGAAGGTAGATTTCAATACGTTCCGGGGCAGGGCCGTGCTGATTGAAAATGTGGCTTCACTCTGA
GGCACAACCACTCGGGACTTCACCCAGCTCAACGAGCTGCAATGCCGCTTTCCCAGGCGCCTGGTGGTCCTTGGCTTCCCTTGCAACCAATTTGGACATCAG
GTGAGGGGTCCCTCCTTG
TAGTGCACCAAAGGTGTTGGGTTGGTGTAGCTCAAGTGGGATAAGGGGAGAGGCTGAATGACCATGTTGGAGTGTCTGGAATAATGGGGTATGTTTTGTTAAGCTAGGTCTTTAGGTGCA
TGTGACATACCAAGGGAAGGTATGTATTTTTTAAGATTAAACACTGAGGCTGTGTGATTTTTATAGTTTACTGTCTTTCTAGTATATTACTCCATGAGGGCTGGTGCCAGGTCTGTGTTT
CTCTCCACTGTGTCCTCAGTGCCTAGGGCATAGAAAGCACTCATTAAGTATTTGTTGAATAAATGAGTGGAGAAAATAGAGGCCAGGAATCAAACAAGAATTGGAGAGACTCAAGAGATC
TTAGCTCTAGCTGGACTTGGTTTTGCTATTTAATGGCTCTGTGCCCTCGGAAAGGGTGCTTCATTTTTCGGTTTAGTTTCCTCATCTGTAAACTGGGGATAATACCACTTAGCTCATAGG
ATTATGATGTTTAGGGGATAGGATATACAAAAGTAACTTGAAGAGTATTAAGTACTTTGCAAATGCAAGCAAATTGATTATTTAGATTGAGGATGATTTTTGTTGGTTTAAATTAGCCAA
GTGGAAAGAGAATAAGCGGGAAAGAGAAAGGTTTTCAACAGGCACGTGCCTCCTCTGGGCATCACATGAACCTCTCTATTTCAGATTAATGGGTCAAGTTGTTATAGATCTTCAGCCCAC
ATACCTCGAGTTCTCTTTTAGGGATTCTTCTATTTCCACCTATGATTTTAATGTACAAGCAGGGAGAATGAACCCAAGTGAACCCTCTCATTATAATCCCCTTAGTTCAATTCACAGTGG
CATGAAGGCGCGGAAGAGAGGAAAGCAGGAAGGCTGAAGCATCACTGGCTGTGACAAACCTGAGCCCAAACTGTTCACTGCTCTCACTGTTCTTCCCTAAGTTTTCTGTCTGGCCTTCTA
GAGCAGGAGAGATAGGACTGGCAAACCTTCTTTCGAGATGTCCCTCCAGCCCCAGAAGTACCTCCAGCCTCACACCATCACTTCAGCCTAGCAAGTTGCTGGAGGGAGTCTATAACCTAC
CAGGAGCCAGCCAGCCATTTGCATTAAGAAATAGAAGTCTGCCAGGGTGCAGAGGCTCACGCTTACAATCCCAGCGCTTTGGGAGGCTAAGGTGGGCAGACTGCTTGAGCTCACGAGTTC
AAGATTAGCCTGAGCAACATGGTGAAACCTTGCCTCTACAAAAATTGCAAAAATTAGCCAGGCGTGGTGGCATGTGCCTGTAGTCTCAGCTACTTGGGAGGCTGAAGTGGGAGGATCGCT
TGAGCCTGGGAAGTCGAGGCTGCAGTGAGCTATGATTGTGCCACCGCACCCAGCCTAGATGACAGAGTGAGGCCCTGTCTCAGGAAAAAAAACAAAAACAGAGAAGTCTACTAGAGATCA
GCTCTGGGCTCATGATGTCATGATGGCCTGGAACTGACTGAACTAGTTTGTTCTCACAGGTCAGAAGCAGGAACTTTCTCCCAGAGGAAGATATCCGCCTCTTAAATTGGAAAGGCAGAG
GTGGAAAAGAAGGGTTCCCACAGGCCTTCTGGGTTGTCATGAGTGGGGATGCTGAGAGGGAATAGGACAGGGATGGCAGTGGGGCGGGAAAGGCAGGGACCAGATTTTGAGCCAAAGCAT
GCGTAGCTGAGAGCAGTGAGTGGACAGGAGGTGCAGCAGTCTTTGGGTAGCACCCTACTCATGAAAAGAATGATAATTACATACAACCTTTAGCCATCAAGCACTTATTTCCTGAATGCC
CCCTCTCGCTGGCCTATTCCCGAACCCTAAATCCTGTATCCTATTTAGTTCACTCCTGTTGGTACTAAGTAGTTCCATTTAGAGTACACATGCATTATTGCCTTGAACTTGCTCTGCTGT
TATGGCACCTGAAAACTAGATGTCCTTGGATGGGGGTCTTCCTTCATCAAAGCTTCTTCTCATTTGTACTTCAGTTCTAGGACAAGGCAAGAAGAAAGCAAGAAGCTGTAAATCCCATTC
CTTTGGGTCTCAATTTCACCCTCAGTTCAAGGAGCTGAATAGGCAGAGGCAAAGGCTATACTCAACACATGTGCAATTGAAAGCAGGCGAGGCAAAACCAGGGCAGAGGGAAAGGGGGTG
TGTGTGTAGGTATGGATATATGGGAAGGTAGGTCGGTAGGTTAGTTGAAGAGGAGGTTCTAAGCAGTATAACCTAAGCCTCTTTTCTCTTTCTTCTGCTTCAAACACCTTAAGAACTGCT
CAGGGTAGACTGGAGACAAAAGCAACAGCTCAGAAGTGCTAAATCTTGAAGAGCAGCCAAAGCATGGGCAACAAAGTGAGACCTCATCTCTACAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAATTAGCCGGGCATAGTGCCCTATGTCTGTAGTCTCAGCTACTAAAGAGGCTGAGGCAGGAGGAATGCTTGAGCCCAGAGATTCAAGGCTGCAGTGAGCGACACCTTGTCTGTCTCTC
TCTCTCTCTCTCCCTCACAGTGAAAAAGAATGATCCTGGGAAGGGAGTGTAGGAGGGTGAAAGAGTTTCATGTTGTGGATCCTTCTTTTCCCCTATCCCTTGTCCATGCTCTTTATCTTT
TTCCTTCCCTAGGAGAACTGTCAGAATGAGGAGATCCTGAACAGTCTCAAGTATGTCCGTCCTGGGGGTGGATACCAGCCTACTTTCACCCTTGTCCAAAAATGTGAGGTGAATGGGCAG
AATGAGCATCCTGTCTTCGCCTACCTGAAGGACAAGCTCCCCTACCCTCATGATGACCCATTTTCCCTCATGACCGATCCCAAGCTCATCATTTGGAGCCCCGTGCGCCGTTCAGATGTG
GCCTGGAACTTTGAGAAGTTCCTCATAGGGCCGGAGGGAGAGCCCTTCCGACGCTACAGCCGCACCTTCCCAACCATCAACATTGAGCCTGACATCAAGCGCCTCCTTAAAGTTGCCATA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCATTGCCAAGTCCTTCTATGGCGTCAGTGCCATCAGCCTGGATGGGGAGAAGGTAGATTTCAATACGTTCCGGGGCAGGGCCGTGCTGATTGAAAATGTGGCTTCACTCTGA
GGCACAACCACTCGGGACTTCACCCAGCTCAACGAGCTGCAATGCCGCTTTCCCAGGCGCCTGGTGGTCCTTGGCTTCCCTTGCAACCAATTTGGACATCAG
GAGAACTGTCAGAATGAG
GAGATCCTGAACAGTCTCAAGTATGTCCGTCCTGGGGGTGGATACCAGCCTACTTTCACCCTTGTCCAAAAATGTGAGGTGAATGGGCAGAATGAGCATCCTGTCTTCGCCTACCTGAAG
GACAAGCTCCCCTACCCTCATGATGACCCATTTTCCCTCATGACCGATCCCAAGCTCATCATTTGGAGCCCCGTGCGCCGTTCAGATGTGGCCTGGAACTTTGAGAAGTTCCTCATAGGG
CCGGAGGGAGAGCCCTTCCGACGCTACAGCCGCACCTTCCCAACCATCAACATTGAGCCTGACATCAAGCGCCTCCTTAAAGTTGCCATA

Retrieve as FASTA