Entry information : HaPrx74 (HanXRQChr10g0294851)
Entry ID 13628
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx74 (HanXRQChr10g0294851)
Name (synonym) HaPrx74 (HanXRQChr10g0294851)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx74
start..stop
S start..stop
HarPrx17 467 1e-168 1..240 1..240
VvPrx12 422 2e-149 1..327 9..328
GhPrx05 416 3e-147 4..327 1..323
ThasPrx44 410 2e-144 12..327 35..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 108772298..108772510 213 N° 2 108772033..108772215 183 N° 3 108771780..108771942 163 N° 4 108770411..108770835 425
complement(join(108770411..108770835,108771780..108771942,108772033..108772215,1 08772298..108772510))


exon

Literature and cross-references HaPrx74 (HanXRQChr10g0294851)
DNA ref. HanXRQ genome:   HanXRQChr10 (108772510..108770411)
Protein sequence: HaPrx74 (HanXRQChr10g0294851)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   36098.23 Transmb domain:   %s   i5-22o
PI (pH):   %s   5.45
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNNMLIVMFGMIISCYILIGISEARLKIGFYNKTCPDAESIVGGFVRDAAEFDPRVPAFLLRLHFHDCFVQGCDGSILIDNGPISEKEAPGHQGLQGFNVIEDTKAQLEFVCPGVVSCADIVAIAARDAVAFSFGPIYKVETGRRDGFVSNKALADKMPDFRDSIQLLKRKFFEKGLNDKDLVVLSGAHTIGTTACFFLMDRLYNFSPRGGPDPSIDQDLLPELMDACPPNGDINFRLPIDHNSGDTFDIQILENIRNGFAVLQSDAKLMDDPVTKRILDSYFRVTNESVKPSFEADFVKSMVKMGRIGIKTGPKRGEIRRVCNTFN

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATAACATGCTAATAGTAATGTTTGGCATGATCATATCATGTTATATATTAATTGGGATTTCAGAAGCTCGTCTGAAAATAGGGTTTTACAACAAAACATGCCCAGATGCAGAATCC
ATTGTCGGTGGCTTTGTTAGGGATGCAGCTGAGTTTGACCCACGAGTTCCTGCTTTCTTGCTCAGGCTTCACTTTCATGACTGCTTTGTTCAG
GTTCTTTAGTTTCTTTAACTCTGAAAG
CACATGAATTTACGGGTTTTGTATGGATTTTTATGACGATTCAATTGAGTTTCAGGGTTGTGATGGATCAATTCTGATAGATAATGGGCCGATCTCGGAGAAAGAAGCACCTGGGCATCA
AGGGTTGCAAGGTTTTAATGTGATAGAGGATACAAAAGCTCAGTTGGAGTTTGTGTGCCCTGGTGTGGTTTCTTGTGCTGATATTGTGGCCATTGCTGCTAGAGATGCTGTTGCTTTT
GT
ATGTTATTTGCATTCTTTTTTTTTTTTTTGCAATTGCAGTTTTTTGAGTGTTTGTGTGGATGATCTGATGTTTGTGTCTGGTTGATAGAGTTTTGGGCCAATTTATAAAGTTGAAACCGG
TAGAAGAGATGGATTTGTTTCAAATAAAGCATTGGCTGACAAGATGCCTGATTTTAGAGACTCAATTCAGCTTCTAAAACGCAAGTTCTTTGAGAAAGGGCTTAATGATAAAGACCTTGT
GGTTCTCAGTG
GTACTCTTCTCTTCTTTTTTTTCTATCTCACTTGTAACAAAATTATTGTTACGATTTGGGTGGGATGGGGAGCAAATATTTCCTCTCTCTCGAAATATAGAGACCGCCC
CGGTTGAGACCACCATCTCGAAAATTTCTTTTTTGAAAATACAAAGTATAACAATTCTCTCTCTCACTCTCTCTATATATATTGAATATGTATGTATATGTCTATATCCCATGCAGATTA
AGTGATCATGTATAGTTGGTAGACATTTTCAGAGGTATGGTATGAACATGAAGAAGTTTCCTTACATTTTCCATCAACCAACTCAGTGTAGAATTTTAATAATTATTTTATGACATTTCA
AGCATTATCTTAATATAATTTTTTTTGTTTAAATTACAAGTTTTAAAACACGGTTGGAAACTAATTTATTGTACATTGCTCAAAATGGTCCCATGACAGAAAACCTAAGGCTAAGGTCCT
ACTCGAGATTCATGAAGGTAAAACTGCCATAAGATCAACATGCGTTATGGGCAATAGATTATTTCATAACATGCTGTTTCTAACATTTTTTTAAGGTAAACAATGTTTTTGTTTTGCTTG
TACGTGCAAGGATTTTGTAAGACATTTTCAGCTAAAATATTTGTTTTGATACAAAATGTCAAACACAATAATAAGAGAAGTAATTCATTACTCTTTTATGGTGACTATTATAAATATATC
TTAATATGAACATATGATTTCACTATTATATTTACACTTTGCTTTCGTAATTGTCCAATTGTAATTGTAATCTCCTTATATAAGAATAAAAAGATTTTTAAGAGTTGTTTTAGGGTGAGA
GAATATTGTTTTAGTTCTCCTTCATTATTCTAACATATGGGGTTACATATACTTATATACATCTCTAATAGTGACATTTAATTTTATTTACTTACTTCATGATGACAAATTTTAGGTGCA
CATACTATCGGTACAACGGCGTGTTTCTTCCTTATGGATCGGCTCTACAATTTCTCGCCTCGTGGGGGTCCGGACCCAAGTATAGATCAGGATCTCCTTCCAGAACTAATGGACGCTTGC
CCTCCAAACGGAGATATAAACTTCAGGTTGCCGATTGATCATAATAGTGGTGACACTTTCGACATTCAAATCCTAGAAAACATCAGGAATGGCTTTGCAGTGCTACAATCTGATGCAAAG
CTCATGGATGATCCAGTGACCAAAAGAATTTTGGACTCGTATTTCAGGGTTACCAACGAATCAGTCAAACCATCTTTTGAGGCGGATTTTGTCAAGTCCATGGTGAAAATGGGTCGCATC
GGAATTAAGACCGGTCCAAAAAGAGGAGAGATTAGACGTGTGTGTAACACGTTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATAACATGCTAATAGTAATGTTTGGCATGATCATATCATGTTATATATTAATTGGGATTTCAGAAGCTCGTCTGAAAATAGGGTTTTACAACAAAACATGCCCAGATGCAGAATCC
ATTGTCGGTGGCTTTGTTAGGGATGCAGCTGAGTTTGACCCACGAGTTCCTGCTTTCTTGCTCAGGCTTCACTTTCATGACTGCTTTGTTCAG
GGTTGTGATGGATCAATTCTGATAGAT
AATGGGCCGATCTCGGAGAAAGAAGCACCTGGGCATCAAGGGTTGCAAGGTTTTAATGTGATAGAGGATACAAAAGCTCAGTTGGAGTTTGTGTGCCCTGGTGTGGTTTCTTGTGCTGAT
ATTGTGGCCATTGCTGCTAGAGATGCTGTTGCTTTT
AGTTTTGGGCCAATTTATAAAGTTGAAACCGGTAGAAGAGATGGATTTGTTTCAAATAAAGCATTGGCTGACAAGATGCCTGAT
TTTAGAGACTCAATTCAGCTTCTAAAACGCAAGTTCTTTGAGAAAGGGCTTAATGATAAAGACCTTGTGGTTCTCAGTG
GTGCACATACTATCGGTACAACGGCGTGTTTCTTCCTTATG
GATCGGCTCTACAATTTCTCGCCTCGTGGGGGTCCGGACCCAAGTATAGATCAGGATCTCCTTCCAGAACTAATGGACGCTTGCCCTCCAAACGGAGATATAAACTTCAGGTTGCCGATT
GATCATAATAGTGGTGACACTTTCGACATTCAAATCCTAGAAAACATCAGGAATGGCTTTGCAGTGCTACAATCTGATGCAAAGCTCATGGATGATCCAGTGACCAAAAGAATTTTGGAC
TCGTATTTCAGGGTTACCAACGAATCAGTCAAACCATCTTTTGAGGCGGATTTTGTCAAGTCCATGGTGAAAATGGGTCGCATCGGAATTAAGACCGGTCCAAAAAGAGGAGAGATTAGA
CGTGTGTGTAACACGTTTAATTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAGAAGTCA CACACACACC AAGGTGAAAA AACACACGTA CACACTAAAG AAAGAATGAA TAACATGCTA ATAGTAATGT TTGGCATGAT CATATCATGT TATATATTAA TTGGGATTTC  AGAAGCTCGT CTGAAAATAG GGTTTTACAA CAAAACATGC CCAGATGCAG AATCCATTGT CGGTGGCTTT GTTAGGGATG CAGCTGAGTT TGACCCACGA GTTCCTGCTT TCTTGCTCAG  GCTTCACTTT CATGACTGCT TTGTTCAGGG TTGTGATGGA TCAATTCTGA TAGATAATGG GCCGATCTCG GAGAAAGAAG CACCTGGGCA TCAAGGGTTG CAAGGTTTTA ATGTGATAGA  GGATACAAAA GCTCAGTTGG AGTTTGTGTG CCCTGGTGTG GTTTCTTGTG CTGATATTGT GGCCATTGCT GCTAGAGATG CTGTTGCTTT TAGTTTTGGG CCAATTTATA AAGTTGAAAC  CGGTAGAAGA GATGGATTTG TTTCAAATAA AGCATTGGCT GACAAGATGC CTGATTTTAG AGACTCAATT CAGCTTCTAA AACGCAAGTT CTTTGAGAAA GGGCTTAATG ATAAAGACCT  TGTGGTTCTC AGTGGTGCAC ATACTATCGG TACAACGGCG TGTTTCTTCC TTATGGATCG GCTCTACAAT TTCTCGCCTC GTGGGGGTCC GGACCCAAGT ATAGATCAGG ATCTCCTTCC  AGAACTAATG GACGCTTGCC CTCCAAACGG AGATATAAAC TTCAGGTTGC CGATTGATCA TAATAGTGGT GACACTTTCG ACATTCAAAT CCTAGAAAAC ATCAGGAATG GCTTTGCAGT  GCTACAATCT GATGCAAAGC TCATGGATGA TCCAGTGACC AAAAGAATTT TGGACTCGTA TTTCAGGGTT ACCAACGAAT CAGTCAAACC ATCTTTTGAG GCGGATTTTG TCAAGTCCAT  GGTGAAAATG GGTCGCATCG GAATTAAGAC CGGTCCAAAA AGAGGAGAGA TTAGACGTGT GTGTAACACG TTTAATTGAC TGAAGTGCTA TTTCTAGTAT CTCTTGTGGA TTTCTAAATA 
ATACTAGTAA ATAAATCTAC GAATGGTTTA TAAATAACTA AGTGATATTA TTTGATGTTA TTATGAATAG ATCAGTGTAT TTGCGTTATG TTATGTTGAT TTGTATTTAA TGTGAA 

Retrieve as FASTA