Entry information : HaPrx[P]76 (HannXRQChr10g0296201)
Entry ID 13630
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2017-11-28 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-11-29 (Christophe Dunand)
Peroxidase information: HaPrx[P]76 (HannXRQChr10g0296201)
Name (synonym) HaPrx[P]76 (HannXRQChr10g0296201)
Class Class III peroxidase     [Orthogroup: Prx005]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx[P]76
start..stop
S start..stop
HaPrx21 625 0 1..334 43..376
HaPrx13 545 0 36..334 36..331
HaPrx20 540 0 1..334 1..330
LsaPrx11 535 0 36..334 33..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 117608476..117608898 423 N° 2 117608199..117608361 163 N° 3 117607686..117608101 416  
complement(join(117607686..117608101,117608199..117608361,117608476..117608898))


exon

Literature and cross-references HaPrx[P]76 (HannXRQChr10g0296201)
DNA ref. HanXRQ genome:   HanXRQChr10 (117608898..117607686)
Protein sequence: HaPrx[P]76 (HannXRQChr10g0296201)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (307)
PWM (Da):   %s   35694.13 (32991.6)  
PI (pH):   %s   8.98 (8.98) Peptide Signal:   %s   cut: 27 range:27-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEISSFSKTVALLVLLLATLTTLSLGQGNRGSGSGTRLGYYRSSCPRAESIVQSAVRSAVQANPTIAPGLLRMFFHDCFVNGCDASILIDGPTTEK*AGPNSLLRGFEVIDASKSQLETACPGVISCADIVALAARDSVVLTGGCSWQVRLGRRDGFVSQASDTANLPAFNDPISVQIRKFADKGLNTKDLVTLVGGHTIGTAACALFSYRLYNFNNTNGPDPDINPAFLPQLRALCPNGGDALRRVALDTGSDNSFGNSFYENLRNRRGVIESDAKLWSDRRTQRFVQRYLGERGQTGSRFNAEFGRAMVKMGNIEVKTGTQGEIRRVCTAT

Retrieve as FASTA  
Remarks Stop in frame
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATTTCCTCCTTTAGCAAAACGGTTGCTTTGTTGGTTCTTCTGTTAGCCACACTCACAACCTTGTCACTAGGTCAAGGCAACCGCGGTAGTGGCAGCGGCACCCGTCTTGGTTAT
TACAGGTCGTCCTGCCCTAGGGCCGAATCCATAGTTCAGTCTGCGGTTCGGTCTGCTGTCCAAGCCAACCCAACAATCGCACCTGGTTTACTAAGGATGTTCTTCCATGACTGCTTTGTC
AATGGTTGTGATGCATCTATACTAATTGATGGACCCACAACTGAGAAGTAAGCAGGCCCAAACTCTCTCTTGAGAGGCTTTGAAGTTATTGATGCTTCAAAGTCCCAGCTCGAAACAGCC
TGCCCAGGAGTGATCTCATGTGCTGATATCGTTGCTCTTGCTGCACGTGATTCTGTGGTCTTG
GTAAGTACATATTTCCTTAACAGTTAACCCTAGCTTCTCATGCTGTTTGTACATTAG
AAACTTGTAGTTATATATGCTTATTGCTTAATCATTTTTTTTAATATATTATTGCAGACCGGTGGATGTAGTTGGCAGGTACGATTAGGACGTAGAGATGGATTTGTTTCACAAGCATCA
GATACCGCAAACTTGCCTGCCTTTAATGACCCTATTAGTGTCCAAATCAGAAAGTTTGCTGATAAAGGCCTCAACACAAAAGATCTTGTTACTCTTGTCG
GTAAGTAGAATAAAGTAATG
TAGAAAAACTAGCTAATGTATAGAATGTTATGGCCTTATTTATAAATTATTTATTTTTTTATTTTTTTGTTTGCCAGGTGGACACACAATTGGAACAGCAGCCTGTGCATTATTCAGCTA
CAGGTTATACAACTTCAACAATACCAATGGACCCGACCCAGATATAAACCCAGCATTCCTACCACAACTCCGAGCACTTTGCCCCAATGGTGGCGATGCATTAAGACGTGTGGCGCTTGA
TACAGGTAGCGATAATAGCTTCGGCAATTCATTCTATGAAAACTTGAGGAATAGAAGGGGAGTTATTGAATCCGATGCAAAGCTATGGAGTGACCGCAGGACTCAGAGGTTTGTACAAAG
GTATTTAGGGGAAAGGGGGCAAACGGGATCGAGATTTAACGCAGAGTTTGGAAGAGCAATGGTGAAGATGGGTAATATTGAGGTGAAAACAGGGACACAAGGTGAAATCCGTAGAGTGTG
TACTGCAACCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATTTCCTCCTTTAGCAAAACGGTTGCTTTGTTGGTTCTTCTGTTAGCCACACTCACAACCTTGTCACTAGGTCAAGGCAACCGCGGTAGTGGCAGCGGCACCCGTCTTGGTTAT
TACAGGTCGTCCTGCCCTAGGGCCGAATCCATAGTTCAGTCTGCGGTTCGGTCTGCTGTCCAAGCCAACCCAACAATCGCACCTGGTTTACTAAGGATGTTCTTCCATGACTGCTTTGTC
AATGGTTGTGATGCATCTATACTAATTGATGGACCCACAACTGAGAAGTAAGCAGGCCCAAACTCTCTCTTGAGAGGCTTTGAAGTTATTGATGCTTCAAAGTCCCAGCTCGAAACAGCC
TGCCCAGGAGTGATCTCATGTGCTGATATCGTTGCTCTTGCTGCACGTGATTCTGTGGTCTTG
ACCGGTGGATGTAGTTGGCAGGTACGATTAGGACGTAGAGATGGATTTGTTTCACAA
GCATCAGATACCGCAAACTTGCCTGCCTTTAATGACCCTATTAGTGTCCAAATCAGAAAGTTTGCTGATAAAGGCCTCAACACAAAAGATCTTGTTACTCTTGTCG
GTGGACACACAATT
GGAACAGCAGCCTGTGCATTATTCAGCTACAGGTTATACAACTTCAACAATACCAATGGACCCGACCCAGATATAAACCCAGCATTCCTACCACAACTCCGAGCACTTTGCCCCAATGGT
GGCGATGCATTAAGACGTGTGGCGCTTGATACAGGTAGCGATAATAGCTTCGGCAATTCATTCTATGAAAACTTGAGGAATAGAAGGGGAGTTATTGAATCCGATGCAAAGCTATGGAGT
GACCGCAGGACTCAGAGGTTTGTACAAAGGTATTTAGGGGAAAGGGGGCAAACGGGATCGAGATTTAACGCAGAGTTTGGAAGAGCAATGGTGAAGATGGGTAATATTGAGGTGAAAACA
GGGACACAAGGTGAAATCCGTAGAGTGTGTACTGCAACCAAT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATTT CCTCCTTTAG CAAAACGGTT GCTTTGTTGG TTCTTCTGTT AGCCACACTC ACAACCTTGT CACTAGGTCA AGGCAACCGC GGTAGTGGCA GCGGCACCCG TCTTGGTTAT  TACAGGTCGT CCTGCCCTAG GGCCGAATCC ATAGTTCAGT CTGCGGTTCG GTCTGCTGTC CAAGCCAACC CAACAATCGC ACCTGGTTTA CTAAGGATGT TCTTCCATGA CTGCTTTGTC  AATGGTTGTG ATGCATCTAT ACTAATTGAT GGACCCACAA CTGAGAAGTA AGCAGGCCCA AACTCTCTCT TGAGAGGCTT TGAAGTTATT GATGCTTCAA AGTCCCAGCT CGAAACAGCC  TGCCCAGGAG TGATCTCATG TGCTGATATC GTTGCTCTTG CTGCACGTGA TTCTGTGGTC TTGACCGGTG GATGTAGTTG GCAGGTACGA TTAGGACGTA GAGATGGATT TGTTTCACAA  GCATCAGATA CCGCAAACTT GCCTGCCTTT AATGACCCTA TTAGTGTCCA AATCAGAAAG TTTGCTGATA AAGGCCTCAA CACAAAAGAT CTTGTTACTC TTGTCGGTGG ACACACAATT  GGAACAGCAG CCTGTGCATT ATTCAGCTAC AGGTTATACA ACTTCAACAA TACCAATGGA CCCGACCCAG ATATAAACCC AGCATTCCTA CCACAACTCC GAGCACTTTG CCCCAATGGT  GGCGATGCAT TAAGACGTGT GGCGCTTGAT ACAGGTAGCG ATAATAGCTT CGGCAATTCA TTCTATGAAA ACTTGAGGAA TAGAAGGGGA GTTATTGAAT CCGATGCAAA GCTATGGAGT  GACCGCAGGA CTCAGAGGTT TGTACAAAGG TATTTAGGGG AAAGGGGGCA AACGGGATCG AGATTTAACG CAGAGTTTGG AAGAGCAATG GTGAAGATGG GTAATATTGA GGTGAAAACA 
GGGACACAAG GTGAAATCCG TAGAGTGTGT ACTGCAACCA ATTGATAAGA TTTATAAGAA TGTGAGT 

Retrieve as FASTA