Entry information : HaPrx[P]91 (HannXRQChr11g0331431)
Entry ID 13645
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2017-11-28 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-11-29 (Christophe Dunand)
Peroxidase information: HaPrx[P]91 (HannXRQChr11g0331431)
Name (synonym) HaPrx[P]91 (HannXRQChr11g0331431)
Class Class III peroxidase     [Orthogroup: Prx016]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx[P]91
start..stop
S start..stop
HaPrx[P]50 381 4e-135 25..249 43..292
LsPrx43 307 7e-106 1..240 17..301
HaPrx04 305 5e-105 1..251 14..311
MePrx02 303 8e-104 2..251 19..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49472030..49472104 75 N° 2 49472121..49472186 66 N° 3 49472295..49472462 168 N° 4 49473205..49473471 267
N° 5 49473492..49473668 177  
join(49472030..49472104,49472121..49472186,49472295..49472462,49473205..49473471 ,49473492..49473668)


exon

Literature and cross-references HaPrx[P]91 (HannXRQChr11g0331431)
DNA ref. HanXRQ genome:   HanXRQChr11 (49472030..49473668)
Protein sequence: HaPrx[P]91 (HannXRQChr11g0331431)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338
PWM (Da):   %s   36875.87  
PI (pH):   %s   10.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
FSFGTSLTSNNYQKTCPAVESLVQKTKRDKTAPAGLLRMHFHDCFIRGCDGSVLLSSKGNNKAEKDGPPNVSLHAFYVVDNAKRAVESVCPGVVSCAYVLYLACYKTNLYALKLYFGRLLTCLTLGIKSGGRSLGFSHCSSFNNRIHNFNSTTDIDPSLHPSFAASLRRVCPAKNNAKKAGVAMDPSSSTLDILQHKVLFSSDNALLNSPKTRSLLSKFASSNDAFSKAFVKSMIKMSCITGAIRRSGRTV

Retrieve as FASTA  
Remarks Several frame shift and missing fragment
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTCTTTTGGAACTTCATTAACCTCAAATAATTACCAAAAAACATGCCCTGCTGTGGAATCATTAGTCCAGAAAGCGGTAACCGACGCAAACAAAACGTGACAAAACTGCCCCGGCGGG
GCTCCTTCGGATGCATTTCCACGACTGTTTTATACGG
GTATGACTATTGACCGGCCATATATTGTTTTGTTTACTAAGTTGTTTATCTTTTAGTTGAAAGGTCCTACTAATGTTAATCTG
TGTTGGTTTTGATGATGAATTGAAGGGGTGTGATGGTTCGGTTTTGTTGAGTTCTAAGGGTAATAACAAAGCTGAAAAAGATGGTCCGCCTAATGTTTCGCTGCATGCGTTTTATGTTGT
TGATAACGCGAAAAGAGCAGTTGAATCTGTGTGTCCTGGTGTGGTCTCATGTGCATATGTATTATATCTGGCG
TATGCACGTCATATACACCTATCTTGTGCACAAAGTATAACTTAAGA
AAATTTAAATGCAGTCTGGAGGACCATCTTGGGTTGTGCCTAAAGGAAGAAAAGATGGAAGAATATCTAAGGCAAGAGAAACCATACAACTACCAGCTCCCACCTTCAACTAAGTTTCTC
TCAGAGAGGTCTATCTTTAGAAGATCTAGCAGCACTTTTAGAAGATCTAGCAGCACCTTCAGGTAATAAATAAGCTTAACACAAAAGAAGAAAAGAAATCATAATTACCTGGTCCCAGGT
ATCTATCATTATACCCATAATAGTCGGCCATATTATTGCTATACAAAATGGAAATGAACATTTACCAATTTATACAACAAATCGTATGGTAGGCAAGTATGAATGTATGATGGTCCTAAT
GCTGATCCTACATGTATTTCGTGTATATATCTCACCGGTAGATTTGAAAAAAAAAACAACGCAAATTAACTTGGGTTACACGTGTGGTTCTGGATGTATTCCTTACCCTGGGACCAAATT
GGTTATTGGGTGGTGAAAATTGGAACAGATGTATTATTTGTTTTTTTTTTTAATTTTTATATGGTTTTTGTGTGCAAGAAATCAAGTTTTCGTATATCGGACTGCGTAACAGGTCAAAAT
TGGTTACGGTCAAAACGGGTCATTTTTATTACACGTGGGATTAGGTTTGATCCCTAAAGATTTTTTTATCCAATATTTTACTTTTCAATAAATAGTGTTACAAAACCAACTTATATGCAT
TGAAATTATACTTTGGGCGACTTTTGACATGTTTGACACTTGGTATTAAATCTGGAGGGCGTTCTCTCGGGTTCTCGCATTGCTCGTCTTTCAACAATAGAATCCACAACTTCAACTCGA
CAACTGACATCGACCCGTCACTCCATCCATCATTTGCTGCAAGCTTAAGACGCGTTTGCCCTGCCAAAAATAATGCAAAGAAAGCAGGAGTCGCAATGGATCCTTCATCTTCTACTTTAG
AT
AAATACATATTACAAATTAAATTTTGCAGCACAAAGTTTTATTTTCTTCAGATAATGCTTTGCTCAATTCCCCCAAGACCAGAAGTTTGCTATCTAAGTTTGCTAGCTCAAATGATGC
TTTTTCGAAAGCGTTTGTCAAGTCGATGATCAAGATGAGTTGCATCACCGGGGCGATCAGGAGATCAGGAAGAACTGTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTCTTTTGGAACTTCATTAACCTCAAATAATTACCAAAAAACATGCCCTGCTGTGGAATCATTAGTCCAGAAAACAAAACGTGACAAAACTGCCCCGGCGGGGCTCCTTCGGATGCAT
TTCCACGACTGTTTTATACGG
GGGTGTGATGGTTCGGTTTTGTTGAGTTCTAAGGGTAATAACAAAGCTGAAAAAGATGGTCCGCCTAATGTTTCGCTGCATGCGTTTTATGTTGTTGAT
AACGCGAAAAGAGCAGTTGAATCTGTGTGTCCTGGTGTGGTCTCATGTGCATATGTATTATATCTGGCG
TGTTACAAAACCAACTTATATGCATTGAAATTATACTTTGGGCGACTTTTG
ACATGTTTGACACTTGGTATTAAATCTGGAGGGCGTTCTCTCGGGTTCTCGCATTGCTCGTCTTTCAACAATAGAATCCACAACTTCAACTCGACAACTGACATCGACCCGTCACTCCAT
CCATCATTTGCTGCAAGCTTAAGACGCGTTTGCCCTGCCAAAAATAATGCAAAGAAAGCAGGAGTCGCAATGGATCCTTCATCTTCTACTTTAGAT
ATTTTGCAGCACAAAGTTTTATTT
TCTTCAGATAATGCTTTGCTCAATTCCCCCAAGACCAGAAGTTTGCTATCTAAGTTTGCTAGCTCAAATGATGCTTTTTCGAAAGCGTTTGTCAAGTCGATGATCAAGATGAGTTGCATC
ACCGGGGCGATCAGGAGATCAGGAAGAACTGTA

Retrieve as FASTA