Entry information : HaPrx132 (HanXRQChr10g0286351.4)
Entry ID 13654
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx132 (HanXRQChr10g0286351.4)
Name (synonym) HaPrx132 (HanXRQChr10g0286351.4)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx132
start..stop
S start..stop
HaPrx[P]70 592 0 1..324 1..324
StPrx32 470 9e-169 8..321 5..317
StPrx34 461 5e-165 8..321 6..319
LePrx22 459 2e-164 8..321 5..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46189327..46189548 222 N° 2 46188676..46188870 195 N° 3 46187944..46188501 558  
complement(join(46187944..46188501,46188676..46188870,46189327..46189548))


exon

Literature and cross-references HaPrx132 (HanXRQChr10g0286351.4)
DNA ref. HanXRQ genome:   HanXRQChr10 (46189548..46187944)
Protein sequence: HaPrx132 (HanXRQChr10g0286351.4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (299)
PWM (Da):   %s   34962.5 (32252.0)  
PI (pH):   %s   5.42 (5.21) Peptide Signal:   %s   cut: 26 range:26-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKMNIISFLSLFLSLILSIATTSSNSGLSSSYYDRVCPEALPTIKRVVEDALAQERRMGASLLRLHFHDCFVNGCDASILLDQTSTIDSEKNAGPNANSARGFEVIDKIKDEVDKVCGRHVVSCADILTVAARDSVVGLGGPSWKAKLGRRDSTTASQTAANANIPAPSMDLPALIKNFEDQGLDEEDLVVLSGAHTLGFAQCRTFRPRIYSDSNIDPAFASHLRTICPQVGGDSTLAPLDPTPSSFDVKYFSNLVSKKGLLNSDQALLSGGETTELVSKYSGSHEEFWEDFAESMIKMGDIKPLTGNRGEIRNNCRKVNSEY*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGATGAATATCATAAGCTTCTTATCTCTTTTTCTTTCTCTCATTCTTTCTATTGCTACAACATCCTCAAACTCAGGTTTGTCATCAAGTTACTATGACCGAGTGTGCCCTGAA
GCTCTCCCGACCATCAAACGTGTGGTGGAGGATGCATTGGCACAAGAACGCCGCATGGGCGCTTCTCTATTGCGTCTTCATTTTCATGATTGTTTTGTTAAC
GTAAGTAACTTCTCTCTA
CCAACTTAATTATAATTGAAATTTTGCAATCGTTATCCATCATAATAGAACTAACACATTCATATGGTTATCAGACCAATCATATAAACAAGTCACCTATGAATTCATTAAGTGTTCAAG
TTGATAACAACAATAGCAGTTTTGCACATTGCAATACGATAGGCTCATGTAATATAAACATTTATCTTAATGTTCCTTCTACTTTAAAAAGTTAACTTGTTTTTATTTGTTATTTGATTA
AACATGTAAATTTCATCAAACTTATGTACCTTTGCTAAACTGAGCAATCAAAAACTTCCATTATACTTTCTGTTGATTTGACAACAATTATGAATAAGGTGTTGCAAGATGAAGTGTTAT
CTTGTATAGCAATGTTTGCATTTAAGAGATTGGAAAGTGTTGGTGTTATTTTTTGAGATTATTTTCTACATGATGCAGGGATGTGATGCTTCCATACTTTTGGATCAAACGTCAACAATA
GATAGTGAGAAAAATGCAGGTCCTAATGCAAATTCAGCCCGGGGATTCGAGGTTATTGACAAAATCAAAGATGAGGTCGACAAAGTTTGTGGTCGCCATGTGGTTTCTTGTGCTGATATA
TTAACTGTTGCTGCACGTGATTCGGTCGTTGGG
GTAAGTAAAATACACTTAACAAGTTTCTAATAGTTCAACCGAGTATACCTATGTGGTACACTTTGGTATGAATGTTTTCATCAAAAA
CATTATTTTGTAATATATGTTGAAAAAAAAAAGTTCGTATGATTATGCATTTTTTGACGTTAATTCTAAAACTTTAATGTTATGCAGCTTGGTGGCCCATCATGGAAAGCCAAACTTGGA
AGAAGAGACTCAACCACCGCTAGCCAAACCGCAGCTAATGCCAACATCCCAGCACCATCCATGGACTTACCGGCCCTAATAAAAAACTTCGAGGATCAAGGGCTAGATGAGGAGGACTTG
GTTGTACTTTCAGGTGCCCACACCTTAGGGTTTGCTCAGTGTCGAACCTTTAGGCCTCGTATTTACAGTGATAGCAACATAGATCCAGCCTTTGCGAGCCACCTTCGAACCATTTGCCCA
CAAGTTGGCGGTGACTCAACGCTTGCACCACTTGACCCGACACCAAGCTCGTTTGACGTAAAATATTTTTCTAATTTAGTGAGTAAAAAAGGGCTTTTGAACTCTGACCAAGCACTATTA
AGTGGTGGTGAAACTACTGAGCTTGTTTCGAAGTACAGTGGTTCCCACGAAGAGTTTTGGGAGGATTTCGCAGAATCTATGATCAAAATGGGTGATATAAAGCCATTAACAGGGAATAGA
GGTGAAATTCGCAATAACTGCAGAAAAGTTAATTCGGAATATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGATGAATATCATAAGCTTCTTATCTCTTTTTCTTTCTCTCATTCTTTCTATTGCTACAACATCCTCAAACTCAGGTTTGTCATCAAGTTACTATGACCGAGTGTGCCCTGAA
GCTCTCCCGACCATCAAACGTGTGGTGGAGGATGCATTGGCACAAGAACGCCGCATGGGCGCTTCTCTATTGCGTCTTCATTTTCATGATTGTTTTGTTAAC
GGATGTGATGCTTCCATA
CTTTTGGATCAAACGTCAACAATAGATAGTGAGAAAAATGCAGGTCCTAATGCAAATTCAGCCCGGGGATTCGAGGTTATTGACAAAATCAAAGATGAGGTCGACAAAGTTTGTGGTCGC
CATGTGGTTTCTTGTGCTGATATATTAACTGTTGCTGCACGTGATTCGGTCGTTGGG
CTTGGTGGCCCATCATGGAAAGCCAAACTTGGAAGAAGAGACTCAACCACCGCTAGCCAAACC
GCAGCTAATGCCAACATCCCAGCACCATCCATGGACTTACCGGCCCTAATAAAAAACTTCGAGGATCAAGGGCTAGATGAGGAGGACTTGGTTGTACTTTCAGGTGCCCACACCTTAGGG
TTTGCTCAGTGTCGAACCTTTAGGCCTCGTATTTACAGTGATAGCAACATAGATCCAGCCTTTGCGAGCCACCTTCGAACCATTTGCCCACAAGTTGGCGGTGACTCAACGCTTGCACCA
CTTGACCCGACACCAAGCTCGTTTGACGTAAAATATTTTTCTAATTTAGTGAGTAAAAAAGGGCTTTTGAACTCTGACCAAGCACTATTAAGTGGTGGTGAAACTACTGAGCTTGTTTCG
AAGTACAGTGGTTCCCACGAAGAGTTTTGGGAGGATTTCGCAGAATCTATGATCAAAATGGGTGATATAAAGCCATTAACAGGGAATAGAGGTGAAATTCGCAATAACTGCAGAAAAGTT
AATTCGGAATATTAA

Retrieve as FASTA