Entry information : HaPrx[P]134 (HanXRQChr17g0551261.2)
Entry ID 13657
Creation 2016-05-09 (Christophe Dunand)
Last sequence changes 2016-05-09 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx[P]134 (HanXRQChr17g0551261.2)
Name (synonym) HaPrx[P]134 (HanXRQChr17g0551261.2)
Class Class III peroxidase     [Orthogroup: Prx040]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx[P]134
start..stop
S start..stop
HaPrx[P]135 363 7e-131 1..188 1..193
HaPrx133 372 3e-130 1..188 272..464
HaPrx[P]125 329 3e-117 1..172 11..187
SsqPrx01_A34-4-23 256 1e-86 1..188 134..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 71291229..71291391 163 N° 2 71291507..71291910 404  
join(71291229..71291391,71291507..71291910)


exon

Literature and cross-references HaPrx[P]134 (HanXRQChr17g0551261.2)
DNA ref. HanXRQ genome:   HanXRQChr17 (71291229..71291910)
Protein sequence: HaPrx[P]134 (HanXRQChr17g0551261.2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   188
PWM (Da):   %s   20426.28  
PI (pH):   %s   8.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGSGWAVPTGRRDGLVSLASDAESIPGPKDSIDDQIKKFANKGLSIEDLVTLVGGHTIGTAGCVTYNYNNTNAPDPAIDQGFLPHLQTLCPLSGDLKRRVALDTNSENNFYNSFYENIRRGRGVLESDSKLWSDPLTQRFAQPFIGASRSHGSTFNKMFAIAMVKMSKIELKTCNQGEIRRVCNRIN

Retrieve as FASTA  
Remarks Pseudogene from genomic (Only exons 3 and 4 have been detected).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTGGGGGAAGTGGTTGGGCAGTGCCAACAGGTCGTCGAGACGGATTAGTTTCACTGGCATCTGATGCAGAAAGCATACCTGGTCCTAAAGACTCCATTGATGACCAAATCAAGAAGTTT
GCTAACAAAGGTCTTAGCATTGAAGATCTTGTTACCCTTGTAG
GTAAGTTAAGACTAAAAGCTAGAACAGTAGCCATAACGACAAATTAACATTGGAATGGATTTAGTTTCAAATGAACT
AACTTGCATATTTTGCGGCTTAATTCAATGATTATCAGGAGGACATACGATTGGGACAGCTGGCTGTGTCACATACAACTACAACAATACTAATGCACCCGACCCTGCTATTGACCAAGG
ATTCCTTCCCCATCTTCAAACCCTATGTCCTCTTAGCGGTGATCTTAAAAGGCGAGTGGCCTTGGATACAAACAGCGAAAACAATTTCTACAACTCATTCTATGAAAACATAAGGCGTGG
ACGAGGAGTACTTGAATCCGATTCAAAGCTGTGGAGTGACCCACTAACACAAAGGTTTGCGCAACCGTTTATTGGAGCTAGCAGATCGCATGGATCGACATTCAACAAGATGTTCGCGAT
AGCAATGGTGAAGATGAGTAAAATTGAGTTAAAGACATGTAATCAAGGAGAAATTCGTAGGGTTTGTAATAGAATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTGGGGGAAGTGGTTGGGCAGTGCCAACAGGTCGTCGAGACGGATTAGTTTCACTGGCATCTGATGCAGAAAGCATACCTGGTCCTAAAGACTCCATTGATGACCAAATCAAGAAGTTT
GCTAACAAAGGTCTTAGCATTGAAGATCTTGTTACCCTTGTAG
GAGGACATACGATTGGGACAGCTGGCTGTGTCACATACAACTACAACAATACTAATGCACCCGACCCTGCTATTGAC
CAAGGATTCCTTCCCCATCTTCAAACCCTATGTCCTCTTAGCGGTGATCTTAAAAGGCGAGTGGCCTTGGATACAAACAGCGAAAACAATTTCTACAACTCATTCTATGAAAACATAAGG
CGTGGACGAGGAGTACTTGAATCCGATTCAAAGCTGTGGAGTGACCCACTAACACAAAGGTTTGCGCAACCGTTTATTGGAGCTAGCAGATCGCATGGATCGACATTCAACAAGATGTTC
GCGATAGCAATGGTGAAGATGAGTAAAATTGAGTTAAAGACATGTAATCAAGGAGAAATTCGTAGGGTTTGTAATAGAATTAATTAA

Retrieve as FASTA