Entry information : HaPrx[P]135 (HanXRQChr17g0551261.3)
Entry ID 13658
Creation 2016-05-09 (Christophe Dunand)
Last sequence changes 2017-12-08 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-12-08 (Christophe Dunand)
Peroxidase information: HaPrx[P]135 (HanXRQChr17g0551261.3)
Name (synonym) HaPrx[P]135 (HanXRQChr17g0551261.3)
Class Class III peroxidase     [Orthogroup: Prx040]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx[P]135
start..stop
S start..stop
HaPrx133 392 3e-138 1..193 272..464
HaPrx[P]134 363 7e-131 1..193 1..188
HaPrx[P]125 345 1e-123 1..177 11..187
SsqPrx01_A34-4-23 266 1e-90 1..193 134..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 71292434..71292596 163 N° 2 71292712..71293127 416  
join(71292434..71292596,71292712..71293127)


exon

Literature and cross-references HaPrx[P]135 (HanXRQChr17g0551261.3)
DNA ref. HanXRQ genome:   HanXRQChr17 (71292434..71293127)
Protein sequence: HaPrx[P]135 (HanXRQChr17g0551261.3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   192
PWM (Da):   %s   20849.44  
PI (pH):   %s   7.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGSGWAVPTGHRDGLVSLASDAESIPGPKDSIDDQIKKFANKGLSIEDLVTLVGGHTIGTAGCVTFSDRLYNYNNTNAPDPAIDQGFLPHLQTLCPLSDDLTRRVALDTNSENNFDNSFYENIRRGRGVLESDSKLWSDPRT*KFAQPFIGASRSHGSTFNKMFAIAMVKMSKIELKTGNQGEIRRVCNRI

Retrieve as FASTA  
Remarks Pseudogene from genomic (only exons 3 and 4 have been detected, stop in frame)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTGGGGGAAGTGGTTGGGCAGTGCCAACAGGTCATCGAGACGGATTAGTTTCACTGGCATCTGATGCAGAAAGCATACCTGGTCCTAAAGACTCCATTGATGACCAAATCAAGAAGTTT
GCTAACAAAGGTCTTAGCATTGAAGATCTTGTTACCCTTGTAG
GTAAGTTAAGACTAAAAGCTAGAACAGTAGGCATAACGACAAATTAACATTGGAATGGATTTAGTTTCAAATGAACT
AACTTGCATATTTTGCGGTTTAATTCAATGATTATCAGGAGGACATACAATTGGGACAGCTGGCTGTGTCACATTCAGTGACAGGCTATACAACTACAACAATACTAATGCACCCGACCC
TGCTATTGACCAAGGATTCCTTCCCCATCTTCAAACCCTATGTCCTCTTAGCGATGATCTTACAAGGCGAGTGGCCTTGGATACAAACAGCGAAAACAATTTCGACAACTCATTCTATGA
AAACATAAGGCGTGGACGAGGAGTACTTGAATCCGATTCAAAGCTGTGGAGTGACCCACGAACATAAAAGTTTGCGCAACCGTTTATTGGAGCTAGCAGATCGCATGGATCGACATTCAA
CAAGATGTTCGCGATAGCAATGGTGAAGATGAGTAAAATTGAGTTAAAGACAGGTAATCAAGGAGAAATTCGTAGGGTTTGTAATAGAATTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTGGGGGAAGTGGTTGGGCAGTGCCAACAGGTCATCGAGACGGATTAGTTTCACTGGCATCTGATGCAGAAAGCATACCTGGTCCTAAAGACTCCATTGATGACCAAATCAAGAAGTTT
GCTAACAAAGGTCTTAGCATTGAAGATCTTGTTACCCTTGTAG
GAGGACATACAATTGGGACAGCTGGCTGTGTCACATTCAGTGACAGGCTATACAACTACAACAATACTAATGCACCC
GACCCTGCTATTGACCAAGGATTCCTTCCCCATCTTCAAACCCTATGTCCTCTTAGCGATGATCTTACAAGGCGAGTGGCCTTGGATACAAACAGCGAAAACAATTTCGACAACTCATTC
TATGAAAACATAAGGCGTGGACGAGGAGTACTTGAATCCGATTCAAAGCTGTGGAGTGACCCACGAACATAAAAGTTTGCGCAACCGTTTATTGGAGCTAGCAGATCGCATGGATCGACA
TTCAACAAGATGTTCGCGATAGCAATGGTGAAGATGAGTAAAATTGAGTTAAAGACAGGTAATCAAGGAGAAATTCGTAGGGTTTGTAATAGAATTAAT

Retrieve as FASTA