Entry information : HaPrxII05 (HanXRQChr10g0318701)
Entry ID 13659
Creation 2016-05-10 (Christophe Dunand)
Last sequence changes 2016-05-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrxII05 (HanXRQChr10g0318701)
Name (synonym) HaPrxII05 (HanXRQChr10g0318701)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrxII05
start..stop
S start..stop
HaPrxII02 308 1e-109 1..162 1..162
VvPrxII03 277 1e-97 1..162 1..162
EguPrxII03 272 1e-95 1..162 1..162
EgrPrxII03 272 1e-95 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 242633683..242633837 155 N° 2 242632255..242632334 80 N° 3 242631931..242632184 254  
complement(join(242631931..242632184,242632255..242632334,242633683..242633837))


exon

Literature and cross-references HaPrxII05 (HanXRQChr10g0318701)
DNA ref. HanXRQ genome:   HanXRQChr10 (242633837..242631931)
Cluster/Prediction ref. HanXRQ:   HanXRQChr10g0318701
Protein sequence: HaPrxII05 (HanXRQChr10g0318701)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17354.08  
PI (pH):   %s   5.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIKVGDSIPDGTLAHFDEKDEMQQVSVHSLAAGKKVVIFGVPGAFTPTCSMKHVPSFIEKSEELKSKGVEELLLIVNDPFVMKAWKKSYPETKNVKFLADGSATYTRALGLELDLAEKGLGVRSRRFALLVDNLKVVVANVEEGGEFTVSGADEILAAL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCGATCAAAGTTGGTGACAGCATTCCCGACGGAACTCTTGCACACTTCGACGAGAAAGATGAGATGCAACAGGTCTCCGTTCACTCTCTCGCCGCCGGCAAGAAAGTCGTCATC
TTTGGTGTCCCCGGTGCCTTTACTCCCACTTGCAG
GTAGGTACCTTTTTTAAACAGGTCCGGTTTTTAACCAAACCGGTTATTTTTGTGTGGGAAAAAACCGGTTTTAAGAAACTGGTTA
GGTTTTTTAACCGGTTTTTCATGATGGGAACCTAAACTGGTATAACTGTTTTGGTTTATAACCGGTTTGTGCCAAAGAAACTGATTAACCGGTTTCGGTTTTTAAACCAGTTTCGAAGAT
CAAGATCCTAACCAGTATACTAACCGGGTTGGAACCGGTTTAAAAAAAAGCGGTTTAAAAAATCCGGTTTTAGTTTTTTTCTTTTTTCCGGTTTCGATCCTAAAACCGTTTTTTTTGTAC
ACCTCTAAATGCATTACAAAGTGGAAACCATAGGGATCATCCATGTAGCTTTGGCAAAAAGTTGGGTACTAAATGCGTTACAAAAAGTTCAAATCACAGGATCATCCATGTACTTTTAGA
ATTTTTAGTTAACCACATGGACGTCAACTTGTTATATATATTTGATTGATTGGCTTTAGGGGTGCAAACGAGCCGAGCTACTCGAACTCGGCTCGAAAAAAAACTCGAACGAGCCAAGCT
TAAACGAGCTCAAGCTCGAGCCTAAAAACAAGCTAAGCCTGAGCTTCGCTTATCGAGCTCGAGCCGGCTCGCGAGCCTTAACGAGCTTTCTTTTTATATATTTTTTTATCAATATATTAA
ACATATATTTAAATAATAATATTTACCATTTATATAAATATAAAAAATAACTAAATTATATGTATAACAATAAATACAATTAATAAATACTAAACTAGTCGAGCCGAGCCGAGCCGAGCT
CGAGCTTGAAAAATTACCTTCGAGCCGAGCTTTAGCTTTAGAAATAAAGCTCGAATCGAGCCGAGCTCGAGCTTTCATATATTAAACGAGCTCGAGCTTGAGCCTGTTCGAGCTCGGGCT
CGGCTCGGCTCTTTACACCCCTAATTGGCTTAAACATAATTAGAGAACTATACAAATGCCCTTTGGCTTGAGCTTACCTAGCCGAGAAAGGGCTCGAGTGGTTTGCTTTGCTGCCTTATA
TATGGTGTGGTTTAACTAAAAAGTGCATAGCGCCCCGCCACGTTGACAATGGGGCACAAGCTTTAACTAACTCACCCTTCAACTATCACGTTGTGGTACAACTAAAAAAAGTGTGATGGG
CTTTTTGGGTGGACCTCATTTCACAATTCCTTCACATGCGTGAAGGGGGTAATGCCTCTCCTCTTGGTGCCCCCCTTTCACGCTTACGTTTCAATGTTTAACGCCAAAAGTTGATGTGGT
TTTGGCACCGACGCCCACAACGTGGAGTGTTAGCGAAGTGATATGTATATTCTTTTGGCGCAGTATGAAGCATGTCCCCAGCTTCATTGAGAAATCTGAAGAACTTAAATCAAAGGGTGT
GGAGGAGCTTTTGTTGATTAGTG
GTAAGTCTTCTAATAAACTAAATTAATTCTATAACTGAAATTATAACTCAAGTGTGTTTTTTATTTGTAGTGAACGACCCTTTTGTGATGAAGGCAT
GGAAAAAGTCATACCCAGAGACCAAAAATGTGAAGTTCTTAGCCGACGGGTCTGCAACTTACACCCGTGCACTTGGGCTTGAGCTTGACCTAGCTGAGAAAGGGCTCGGTGTTAGGTCAA
GGCGGTTCGCTTTGTTGGTGGATAACTTGAAGGTGGTGGTTGCTAATGTTGAAGAAGGTGGTGAGTTCACTGTGTCTGGTGCAGATGAGATCTTGGCGGCTCTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCGATCAAAGTTGGTGACAGCATTCCCGACGGAACTCTTGCACACTTCGACGAGAAAGATGAGATGCAACAGGTCTCCGTTCACTCTCTCGCCGCCGGCAAGAAAGTCGTCATC
TTTGGTGTCCCCGGTGCCTTTACTCCCACTTGCAG
TATGAAGCATGTCCCCAGCTTCATTGAGAAATCTGAAGAACTTAAATCAAAGGGTGTGGAGGAGCTTTTGTTGATTAGTGTGAAC
GACCCTTTTGTGATGAAGGCATGGAAAAAGTCATACCCAGAGACCAAAAATGTGAAGTTCTTAGCCGACGGGTCTGCAACTTACACCCGTGCACTTGGGCTTGAGCTTGACCTAGCTGAG
AAAGGGCTCGGTGTTAGGTCAAGGCGGTTCGCTTTGTTGGTGGATAACTTGAAGGTGGTGGTTGCTAATGTTGAAGAAGGTGGTGAGTTCACTGTGTCTGGTGCAGATGAGATCTTGGCG
GCTCTGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTTTATAGT AAGAAGCTGG ACCCGAAACA CTTTAAAAAA TATAATAATA ATTCCGTGAA GTCCGCCCCA CCCTACACTA TAAATAAATA CTTGAACCAG TCCCTCGTCA TCAAATGGCT  CCGATCAAAG TTGGTGACAG CATTCCCGAC GGAACTCTTG CACACTTCGA CGAGAAAGAT GAGATGCAAC AGGTCTCCGT TCACTCTCTC GCCGCCGGCA AGAAAGTCGT CATCTTTGGT  GTCCCCGGTG CCTTTACTCC CACTTGCAGT ATGAAGCATG TCCCCAGCTT CATTGAGAAA TCTGAAGAAC TTAAATCAAA GGGTGTGGAG GAGCTTTTGT TGATTAGTGT GAACGACCCT  TTTGTGATGA AGGCATGGAA AAAGTCATAC CCAGAGACCA AAAATGTGAA GTTCTTAGCC GACGGGTCTG CAACTTACAC CCGTGCACTT GGGCTTGAGC TTGACCTAGC TGAGAAAGGG  CTCGGTGTTA GGTCAAGGCG GTTCGCTTTG TTGGTGGATA ACTTGAAGGT GGTGGTTGCT AATGTTGAAG AAGGTGGTGA GTTCACTGTG TCTGGTGCAG ATGAGATCTT GGCGGCTCTG  TAAATTACTC TATAAGATCA TTTAGTAGCG TTTTGGTTTA TGGAGATTGA GGAGTATTTT GTGGAATACT TGTTAAAGAT AGTTAAAATA AATGGAGTAA AATAACATGT TTGTGGTTCT 
CAACTCTCAA GTGTCCTTGG TTTATGGTTG AAGCAGTATT TTGTGGAATA CAATAATAAA AGAGTAAAAG TATAAACTGA AAGTCGTAC 

Retrieve as FASTA