Entry information : HaKat[P]03 (HanXRQChr04g0096431)
Entry ID 13669
Creation 2016-05-11 (Christophe Dunand)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaKat[P]03 (HanXRQChr04g0096431)
Name (synonym) HaKat[P]03 (HanXRQChr04g0096431)
Class Catalase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaKat[P]03
start..stop
S start..stop
HaKat05 143 4e-42 52..124 420..492
HaKat08 128 2e-36 52..124 430..502
EcamKat13 107 6e-32 39..120 17..99
BnKat02_other 112 1e-30 53..124 421..492
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8407648..8407701 54 N° 2 8408063..8408161 99 N° 3 8410143..8410210 68 N° 4 8410292..8410385 94
N° 5 8410683..8410739 57  
join(8407648..8407701,8408063..8408161,8410143..8410210,8410292..8410385,8410683 ..8410739)


exon

Literature and cross-references HaKat[P]03 (HanXRQChr04g0096431)
DNA ref. HanXRQ genome:   HanXRQChr04 (8407648..8410739)
Protein sequence: HaKat[P]03 (HanXRQChr04g0096431)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   124
PWM (Da):   %s   14572.38  
PI (pH):   %s   9.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTAWGFRSKQPCGNLAKCFKEVKDDVFQGDDGYPLKACYPLMLHVFFKFLETVIPKYNDFKQPGDRYRSWDLARQERFIVRMCKILSDPRVTHELRSIWISYWTAYQSLGQKIASRLNVHPNY

Retrieve as FASTA  
Remarks Pseudogene from genomic (first 420 aa are missing)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGGCTTGGGGGTTTCGGTCGAAACAACCATGTGGAAATCTAGCCAAGTGTGTATACACTTGAGGTGAGTTCATAACCCCTCTTTTCTAATTGTTTTTAAATATCATTGCGACTGAT
CATGTAAAAGGAGTTAATTGTCTCGGAAGGGTTTATTAAATCGTATATTGTATATTGACGGTTATAATTTAAGTAGCTGAATGTCCCATTTAGGTGACCTCCAGTGTTGTTTTGAATAGG
ATTGAAAGGGATATGTTTTAATGAGTTAATTAACCAAAGATTGTGTGAAAAATTTGGGTAACATACTGGTTAAAGGGTTAGTATGTTTAGACATTACAATAGCTTGAAATTGTGAATACG
TGTATTGTTAACCATATAAAATATTTATGTGTTGTAGAGATGATTGTGAGCTGAGTTTAAAGAGGTCAAAGATGATGTGTTTCAAGGTGACGACGGCTACCCACTTAAAGCATGCTACCC
ACTGATGTTACATGTGTTCTTCAAATTCTTAGAG
GTATATATATGCTCTCATAGTGAAATTATATATGTATTAAGATGATAAGTTGAAGTAGATCTGTTTTCTTGATAAATTAAGATGAT
AAGTTGAAGTAGATCTGTTTTCTTGATAATAAAATGTGGATTTTTTTTCCAAGAAAGCCCTTTCACCAATGGCTATTGTTGTGCTTCTAAAGGTTACTTTTTCGCTTTCAATTTAAATTT
GTGTTAAATATCATGTATTAGTAGTTTTCTTATGGTGTTGATTGGTTTTTTATTGGTTCGGTTCAACTTTAAAGTGGTTTCAAATGAGAGGAATACAAACCAGTTAAAAACCTACGGTTT
GTACCAGCTCTGAACCGGTTCTATATATACCAACTATAAACCGGTTTCTGTTCGGGTTGGTTAGCCGGTTTTAGTTTTCAAACCGGATTGAATGTGCATCTTTACACTCCTCTGCTACCA
CACTACACCAACACCCAAACATACTAGCTTCCAGAAACCGCTCATTCATCGTAAATTTTTTACAAGGTTCTTGCTGCTTCCTTCTTATCAACGATTTCAAAAGCTATTGCACCCCTTCTT
TTTTTTTTCTTGGTGCTTTTAGTGATTGTTATTGTCATTCCTCAATTTATAAAAATACTAATTAAGGGGTTATGTAACAAAATCGGGTTGTTGATAAGGATCAAGATAGTGGTTCTGCCA
ATTCTAGGTCTAAGGTCAACGATGGTCGGTGAGTAAATAACTAACCATGTATGTTTCTATAGATCGAAAATAAACTCATGTTATTCAAAATTGTTTGGTTTAGTTTTACAGTGATTATGA
CAATTATGTTTTTTGTTTGTTTTGTATTATAATAGGATGAAGATGTGATTGCTTGCATATAAACAAGGGTTTCAGATGAACTAATACATGGTGTTCTCTTTTATAAATAATTCTTAACAA
TTTGTGATTTTTTTATTCGATTTTTTCAGTTCAATGTTATAATTTAACATTTTTATAAGTAATGGAATTTTTTCTTTCACTTCAAACGTGTCATTTAAATAAAGTGTCGGTTTGGTCGGG
TTAAGAAGGTTACATGTAGAGTTAGTTACTTCGTTTATTTTTTTAATTAAGAAATAAGTTACCTCATGTATTCTTTATTTCTTTATATTTACAAACCGAAAGATAGTATTGTTGATGCTC
CTTAATACCCCCTATTCATGAAATTATAATCAGTGGCGGAGCTTGACCAAAAGTTTCGATGGGGCGTAAAGTGATGGGATCCAACTTTTTTCCTATCGTTATGTTTCGGGTCGGGTCAGC
TATTGATTCGGGTCAGGTCAAATAATAATAGTTGCAAATAAAGTCAAAAAATTTCATTCATTCAAAGGACCCGTTCTTACACATAAAAACTTGCGATTAAGTTTATTGTGTGGTGTGTAA
TCTAGGGTTAAACAAATAAGACTTAAAATATATTTACAAAACTACCCATCACTTATATACAAAGTGATAACAAATTTTACTTTAATTTGTATATTGTATAAATATTTAGGATATACAAAG
TGGTAACAAACTTTACTTTAATTTATATATTGTATAAATATTTAGGAAAAATAATTGGGGGGAGACGATCCTATATAATTTTTAAAATTTTCGGACGAAAAATTGGAACCTGTACACTTC
TAACCGAAACATTGGGGTGGGCGGGTGCACCCCCGAACACCAACTAACCTTCGCCACTGATTATAATATATATTTAATTCATACACTTTAGTATTTCTCATAAGAGTACTGTAGCTATTG
TAGTTGCTTTTAAATTATGTCATATAGCTTTTAATTTTACAGCTCAACTTTCATCTTAATAAATATATATTTGGTACACAGGTAGAGAGAGAACGGACGGGTTGGGTGATGGGCCACTTG
AGTTTGGGCAAAAGGGCCACCTCAATAGTAACAAGCACCAAGTAAATGAATGTGTTTATTTATTTATTTTTTTTATTTTAATTTTGTGAATGCAGACTGTGATCCCAAAATATAACGATT
TCAAGCAGCCCGGAGACAGATACCGATCATGGGATCTAGCCAG
GTACGTGTTTTATATGGTTTGTTTTTTTAAAATATTCCAAGATGCCATAAATTTGCTAAACTATGTCTGATCTTTCT
ATAGGCAAGAGAGATTCATTGTCCGAATGTGTAAGATATTGTCTGACCCACGGGTAACCCATGAACTCCGCAGTATTTGGATCTCCTACTGGACCCAGGTTTGTACACGCTTCCCATCTT
AAGTCTTACTTTCATTCCCACAAAAGAAAACGTTCATCCATCCCATTATATTTACAAAAAAAATACCTTTAGTATAGTTTAGAACTTCAATGCATCGTGTTCTTAATAAGTTTACGTCAA
ATGGAAGAAGTTACAGCTGGTAAAATGGGTGGGTTGAGTAACGGATAAACGGGCCAATCTAAACATGTGATTTTTTAGTACGAGCCAAAACAGGCTTAAAAACTTTCTTTAGAAATATAT
GCTGAGTTGGTACATTTTGGGTGGTGTTGTTGCAGGCTTACCAGTCTCTGGGGCAGAAGATAGCATCACGCCTCAATGTGCACCCCAATTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGGCTTGGGGGTTTCGGTCGAAACAACCATGTGGAAATCTAGCCAAGTGTTTTAAAGAGGTCAAAGATGATGTGTTTCAAGGTGACGACGGCTACCCACTTAAAGCATGCTACCCA
CTGATGTTACATGTGTTCTTCAAATTCTTAGAG
ACTGTGATCCCAAAATATAACGATTTCAAGCAGCCCGGAGACAGATACCGATCATGGGATCTAGCCAGGCAAGAGAGATTCATTGTC
CGAATGTGTAAGATATTGTCTGACCCACGGGTAACCCATGAACTCCGCAGTATTTGGATCTCCTACTGGACCCAG
GCTTACCAGTCTCTGGGGCAGAAGATAGCATCACGCCTCAATGTG
CACCCCAATTAT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCTGTAGGG GCTGCCGGTG TCAGTTGAAA GCGCCAGTGA ATGACGGCTT GGGGGTTTCG GTCGAAACAA CCATGTGGAA ATCTAGCCAA GTGTTTTAAA GAGGTCAAAG ATGATGTGTT  TCAAGGTGAC GACGGCTACC CACTTAAAGC ATGCTACCCA CTGATGTTAC ATGTGTTCTT CAAATTCTTA GAGACTGTGA TCCCAAAATA TAACGATTTC AAGCAGCCCG GAGACAGATA  CCGATCATGG GATCTAGCCA GGCAAGAGAG ATTCATTGTC CGAATGTGTA AGATATTGTC TGACCCACGG GTAACCCATG AACTCCGCAG TATTTGGATC TCCTACTGGA CCCAGGCTTA  CCAGTCTCTG GGGCAGAAGA TAGCATCACG CCTCAATGTG CACCCCAATT ATTGAACACG GTTATCTTGA GTTTGGGCCC GCTTAAGCTA GATTGATGAT CATGCTATAG TAGGTCCATC  TCTAAGATTG TTATGTTACA CAAGCGGTGT TGTATGTATC AGTCCTACCT TTCGTCTGTA ATATTTTATC ATACTTAAGG AACCTGAAAC TTAGAATAAG TGCACACCTA GATGTGTGAG 

Retrieve as FASTA