Entry information : HaGPx03 (HanXRQChr03g0086571)
Entry ID 13676
Creation 2016-05-11 (Christophe Dunand)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGPx03 (HanXRQChr03g0086571)
Name (synonym) HaGPx03 (HanXRQChr03g0086571)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGPx03
start..stop
S start..stop
HaGPx08 322 3e-114 69..235 1..166
HaGPx06 305 3e-107 69..235 1..167
HaGPx08_psc8 303 1e-106 69..235 1..166
CsGPx06 283 6e-98 14..235 6..227
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 146703047..146703295 249 N° 2 146704093..146704169 77 N° 3 146704354..146704415 62 N° 4 146704500..146704618 119
N° 5 146704710..146704877 168 N° 6 146704966..146704995 30  
join(146703047..146703295,146704093..146704169,146704354..146704415,146704500..1 46704618,146704710..146704877,146704966..146704995)


exon

Literature and cross-references HaGPx03 (HanXRQChr03g0086571)
DNA ref. HanXRQ genome:   HanXRQChr03 (146703047..146704995)
Cluster/Prediction ref. HanXRQ:   HanXRQChr03g0086571
Protein sequence: HaGPx03 (HanXRQChr03g0086571)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   235
PWM (Da):   %s   26187.56  
PI (pH):   %s   9.93
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSCSSVRVFNNLIAQRFLIIPSRTLSNSLSISSVSSISNPTGLKRSWLSTRFCGTNRTLVWGTRSFQSMATQSKQSVYDFTVKDAKGQEVDLSKFRGKVLLIVNVASQCGFTNSNYPELTTLYQKYKDGLEILAFPSNQFNGQEPGTNDEIQEFVCTRFKAEYPVFAVDVNGKKAEPLYDFLKSSKGGLLGDSIKWNFTKFLVDREGKVVDRYAPTTTPLSIEKDIKKLLGVA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTGTTCATCAGTTCGTGTCTTCAACAACCTTATCGCTCAAAGATTTCTTATCATCCCTTCAAGAACCCTTTCAAATTCTCTGTCAATTTCATCTGTTTCTTCAATTTCTAATCCA
ACAGGCTTAAAAAGATCTTGGCTTTCTACAAGATTTTGTGGTACCAACAGAACCCTAGTGTGGGGTACAAGATCATTTCAATCTATGGCGACTCAATCGAAGCAATCTGTTTATGATTTC
ACTGTTAAG
GTTTGTTTTCTTTTTAGGGTTTTCAAATGAAATGATTTTTGTTTGTTAAAGATTTGTTTCACATTGTGGATTTTACAAGTTTGATGTGAAATTGTTGTTAGTGTGTTGTTA
TCTTGATTTTAGGGTTTTAAAATGATCTTCATTGATTATTGTATGTCATTAGATCTTGATCTTGTTTTTTTTTTTTTTTTTTTTTTTTGTTGATGGCCTTGATGGATACCTTGAAAGATT
GTTTCTTTGTTTATTCTTTTTACATTTTTTTGTTTTTGGTTTTTGTTGATGGCCTTGATGGGTACCTTGAAAGATTGTTTCTTTGTTTATTCTTTTTACTTTCTTTTGTTTTTGGTTTAT
TGTTGATGGCCTTGATGGGTACCTTGAAAGATTGTTTCTTTGTTTATTTTTTTAACTTTTTTTTTTGTTTTTGGTTAATGGGTACCTTGAAGGATTGTTTCTTTGTTTATTTTTTTTTTT
TACTTTTTTTCGGTTGATGGGTACCTTGAAAGATTGTATCTTTGTTTAATTGTTTATTAATGGGTGTACTGAAAGATTGTTTCTTGATCTCTATGCTTTTATCTTTTTATTAATGGGTGT
CATGAAAGATTGTTTCTTGATTTTTTTTTTTTTTTTTTTTTGATTAATGGGTATTTTGAAAGATTGTTTTTTTTTCATCCTTTTTTGGGTAAATGGGTTATCTTGAAAGAATGTTTCTTG
ATCTTGATCTTTTTTTATTGGTAAATGGGTATTTTGTAAGAATGTTTCTTGATCTTGATCTTTGTTTTTTGTTGGTTTTCATTCAGGATGCAAAGGGCCAAGAAGTGGATCTTAGCAAGT
TCAGGGGAAAAGTCTTGTTGATTGTTAATGTTGCATCACAATG
GTAAACTATATGTCTCCATAATTAACCTCTTGTTTTTTTTAACAATAACTTTTTACCACCTAACCTTCACTTCCAAT
GATTCGATTCGGGCAAAACACGATACCACTAGATCACTAGGTCATACGTATAATTAACCTCTTATTAATGAGCTCTTTCTTTAACTTCTGATATTGTTGTGTTGCAGTGGGTTCACAAAT
TCTAACTACCCTGAGCTGACAACCTTGTACCAGAAGTACAAGGATCAAG
GTTCGGTTTTCCTATTGTTTAACTTCTCCACATCTTGGAATAACTTCCTGTAACTTAAAATCTTGTTGTTA
TATGATTTTACAGGTCTTGAGATACTTGCATTTCCATCCAATCAGTTTAATGGGCAAGAACCAGGAACTAATGATGAGATCCAAGAGTTTGTTTGCACTCGCTTTAAAGCCGAGTATCCC
GTCTTTGCCAAG
GTTGGTATTGTTCAAACTGTTTCATAAAACTTAACAAATACTATTCGGTTGTGTTTCGCTGATCAAATTCGTTGTCCAACGGTTAATGTAGGTTGATGTGAACGGCAA
AAAGGCCGAACCGCTGTACGATTTCTTGAAATCAAGCAAAGGAGGGCTTCTTGGTGACAGCATCAAGTGGAACTTCACTAAATTTCTGGTTGATAGAGAGGGAAAAGTAGTTGACCGTTA
TGCTCCAACCACCACTCCTCTCAGCATTGAG
GTAAACCGCGTTTTGTAACATAATCTTGTCGAAATTTGGCATGTGGGAAGCTCATGTTTTCTTGTTTGGTTTTGTTTTGTTATTGCAGA
AGGATATAAAGAAGCTGCTTGGGGTTGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTGTTCATCAGTTCGTGTCTTCAACAACCTTATCGCTCAAAGATTTCTTATCATCCCTTCAAGAACCCTTTCAAATTCTCTGTCAATTTCATCTGTTTCTTCAATTTCTAATCCA
ACAGGCTTAAAAAGATCTTGGCTTTCTACAAGATTTTGTGGTACCAACAGAACCCTAGTGTGGGGTACAAGATCATTTCAATCTATGGCGACTCAATCGAAGCAATCTGTTTATGATTTC
ACTGTTAAG
GATGCAAAGGGCCAAGAAGTGGATCTTAGCAAGTTCAGGGGAAAAGTCTTGTTGATTGTTAATGTTGCATCACAATGTGGGTTCACAAATTCTAACTACCCTGAGCTGACA
ACCTTGTACCAGAAGTACAAGGATCAAG
GTCTTGAGATACTTGCATTTCCATCCAATCAGTTTAATGGGCAAGAACCAGGAACTAATGATGAGATCCAAGAGTTTGTTTGCACTCGCTTT
AAAGCCGAGTATCCCGTCTTTGCCAAG
GTTGATGTGAACGGCAAAAAGGCCGAACCGCTGTACGATTTCTTGAAATCAAGCAAAGGAGGGCTTCTTGGTGACAGCATCAAGTGGAACTTC
ACTAAATTTCTGGTTGATAGAGAGGGAAAAGTAGTTGACCGTTATGCTCCAACCACCACTCCTCTCAGCATTGAG
AAGGATATAAAGAAGCTGCTTGGGGTTGCT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGCCTCCAC GACAACCACC GTGGCTTCGA ACCGCCACGA CTGCCACGTA AGCACAACCT ACAACGACCA CGTATCAACC TCAATACCCA CATTCCACCC ACGCAAACGA GATTTATACC  GTCATCATCT GTAGGAGATT TGTATAAATC AGAACCCCAA TGTCGTGTTC ATCAGTTCGT GTCTTCAACA ACCTTATCGC TCAAAGATTT CTTATCATCC CTTCAAGAAC CCTTTCAAAT  TCTCTGTCAA TTTCATCTGT TTCTTCAATT TCTAATCCAA CAGGCTTAAA AAGATCTTGG CTTTCTACAA GATTTTGTGG TACCAACAGA ACCCTAGTGT GGGGTACAAG ATCATTTCAA  TCTATGGCGA CTCAATCGAA GCAATCTGTT TATGATTTCA CTGTTAAGGA TGCAAAGGGC CAAGAAGTGG ATCTTAGCAA GTTCAGGGGA AAAGTCTTGT TGATTGTTAA TGTTGCATCA  CAATGTGGGT TCACAAATTC TAACTACCCT GAGCTGACAA CCTTGTACCA GAAGTACAAG GATCAAGGTC TTGAGATACT TGCATTTCCA TCCAATCAGT TTAATGGGCA AGAACCAGGA  ACTAATGATG AGATCCAAGA GTTTGTTTGC ACTCGCTTTA AAGCCGAGTA TCCCGTCTTT GCCAAGGTTG ATGTGAACGG CAAAAAGGCC GAACCGCTGT ACGATTTCTT GAAATCAAGC  AAAGGAGGGC TTCTTGGTGA CAGCATCAAG TGGAACTTCA CTAAATTTCT GGTTGATAGA GAGGGAAAAG TAGTTGACCG TTATGCTCCA ACCACCACTC CTCTCAGCAT TGAGAAGGAT  ATAAAGAAGC TGCTTGGGGT TGCTTAAGTG TTGCTGCACT CATGTGCTCT TGTTTGGTTT TATGTGATTT CCAGCTTTGA ACTTTTATCT TCTGAACCTA GTTTATATAG AAGCTAAGTT 
TGTAGTAATA AAACAACATT TTACATGTTT GGTAAAGAGA TCTGTTTGAA TATGATCAAT ATCATTGTTT TTAAACTTGT 

Retrieve as FASTA