Entry information : HaAOX01 (HanXRQChr03g0081111)
Entry ID 13681
Creation 2016-05-12 (Christophe Dunand)
Last sequence changes 2016-05-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaAOX01 (HanXRQChr03g0081111)
Name (synonym) HaAOX01 (HanXRQChr03g0081111)
Class Alternative Oxidase    [Orthogroup: AOX001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaAOX01
start..stop
S start..stop
HaAOX02 615 0 1..335 1..312
HaAOX04 550 0 1..335 1..342
AtAOX03 527 0 1..335 2..354
ThasAOX02 515 0 38..335 38..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 129766702..129767031 330 N° 2 129767136..129767264 129 N° 3 129768015..129768503 489 N° 4 129768601..129768657 57
join(129766702..129767031,129767136..129767264,129768015..129768503,129768601..1 29768657)


exon

Literature and cross-references HaAOX01 (HanXRQChr03g0081111)
DNA ref. HanXRQ genome:   HanXRQChr03 (129766702..129768657)
Protein sequence: HaAOX01 (HanXRQChr03g0081111)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335
PWM (Da):   %s   37781.22  
PI (pH):   %s   8.71
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMSRGSTTVVRSVRLFSTGSVIRPVRTGGSEKAVVTSWIRSYSVAGGRNASTMTLGEKEVKEQPDIKDTVAGGGAAAGGEKEKEVVSYWGVQPSKVTKEDGTEWKWNCFRPWETYQADLSIDLKKHHVPKTFLDKFAYWTVKSLRLPTDIFFQRRYGCRAMMLETVAAVPGMVGGMLLHCKSLRRFEHSGGWIKALLEEAENERMHLMTFMEVAKPKWYERALVFTVQGIFFNAYFLAYLASPKLAHRITGYLEEEAIHSYTEFLKELDKGNIENVKAPAIAIDYWRLPADSTLRDVVMVVRADEAHHRDVNHFASDIHYQGLELKDSPAPIGYH

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGTCGCGGATCAACAACTGTTGTCCGATCCGTTCGGCTATTCTCAACCGGTTCCGTGATCCGCCCGGTTCGAACCGGTGGATCTGAAAAGGCGGTGGTGACGTCGTGGATTAGA
TCGTATTCGGTGGCTGGTGGTCGCAATGCGAGTACAATGACGTTGGGGGAGAAAGAAGTGAAAGAACAGCCGGATATTAAGGATACGGTGGCCGGCGGTGGTGCAGCCGCCGGAGGTGAG
AAAGAGAAAGAGGTGGTGAGTTATTGGGGAGTGCAACCGTCGAAAGTTACGAAAGAAGATGGTACTGAGTGGAAGTGGAATTGTTTTAGG
GTATGTTTCTAGTTTGTTAATGTTAATTAG
ATGATTTTTTTAGGGTTTATTGATCACTAATTCATAATATAGTAGACAGTTATTTGATTGAGTGTTAATTGTAGCCATGGGAGACGTATCAAGCGGATCTGTCGATTGATTTGAAGAAGC
ATCATGTTCCGAAGACGTTTTTGGATAAGTTTGCGTACTGGACTGTTAAGTCGCTCCGATTGCCTACTGATATTTTCTTTCAG
GTTGACTTACTTTGACTAACTCTCTTCTCTAGTTCTC
TAAATGTTTATAGATATTTTGAGGAAAAAAATGTTGTAGATTTTTTGGTATGAAATGTATATAAATAATAAGGTTATATGTTGGTATGCAAAAGATATGTTAATTTGGTGAAAAAAGTAT
GTTTAGGTGGTTAATGATTATAAAAAGTGTTTTTAGGTGGTTTTTAGGTTTTAGTTGTTTCTGTAGTAATATTTAAGTTTTGAAAAAGTATATACAATTTTGTATAATTTTTTTTTCAGC
ATTCTGGTATATAATTTATTAAAAATCAAGTTGATTTGAATAAATTATTGAAAAAAATATGTTTAGGTGGTTAATGATTATGGAAAGTGTTTTTTTGGTGTTTTTAGGTATGTGGCTGTT
TCTCTAGTAATATTTAAGTTTTAAAAAAAGTATATACAATTTTGTATAATTTTTTTTCAATATTCTGGTATATTTTTTTAAAAATCAAGTTGATTCCAGTAATATATTTTTTTATGAAAT
AAATTAATTTTATTGGAACTGTTTTTTTTTTATAAAGTTTATGTTGGAATATCGGGAAAAAGAAAAGTTTAAAAACAAAAGTGTATATGTAGATTTTTTTTGATTAAATATTACAAATGA
CTTAAGAAAAAATATATTATGTGTTAAATGAATTGTTAGAAAAAAAATTAATTATAACCTTTTGACTTTGCTACTTAATAGTTGTGCTAAAACTTGATTTAATTATATAACAGAGGAGAT
ACGGGTGTCGAGCAATGATGCTTGAAACCGTGGCTGCGGTTCCTGGAATGGTTGGAGGAATGCTTCTTCACTGTAAATCCCTTAGGCGGTTCGAGCACAGTGGTGGATGGATCAAAGCGC
TGTTAGAAGAAGCTGAGAATGAGAGAATGCACTTAATGACTTTCATGGAGGTTGCTAAGCCGAAATGGTATGAGCGCGCTCTTGTGTTCACTGTTCAGGGCATATTCTTCAATGCCTACT
TTCTTGCGTACCTTGCTTCGCCTAAGTTGGCTCACCGGATCACTGGGTACCTTGAGGAAGAAGCAATCCACTCGTACACTGAGTTCTTGAAGGAGCTTGACAAAGGCAACATAGAAAATG
TTAAGGCGCCAGCCATTGCTATTGACTATTGGCGTCTTCCAGCTGATTCGACGCTTCGTGATGTTGTTATGGTTGTGAGAGCAGATGAGGCCCATCATCGTGATGTTAATCACTTTGCTT
CG
GTACTTGTTACACTTTCAGTTTTTAATGTGCTCTTTTATGCCAAATTTGATTTTATATATGCCATTTTATGACCTTTGTGTATTGAATATGTTGCAGGACATACATTACCAAGGACTC
GAGCTTAAGGATTCTCCGGCTCCAATCGGATATCAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGTCGCGGATCAACAACTGTTGTCCGATCCGTTCGGCTATTCTCAACCGGTTCCGTGATCCGCCCGGTTCGAACCGGTGGATCTGAAAAGGCGGTGGTGACGTCGTGGATTAGA
TCGTATTCGGTGGCTGGTGGTCGCAATGCGAGTACAATGACGTTGGGGGAGAAAGAAGTGAAAGAACAGCCGGATATTAAGGATACGGTGGCCGGCGGTGGTGCAGCCGCCGGAGGTGAG
AAAGAGAAAGAGGTGGTGAGTTATTGGGGAGTGCAACCGTCGAAAGTTACGAAAGAAGATGGTACTGAGTGGAAGTGGAATTGTTTTAGG
CCATGGGAGACGTATCAAGCGGATCTGTCG
ATTGATTTGAAGAAGCATCATGTTCCGAAGACGTTTTTGGATAAGTTTGCGTACTGGACTGTTAAGTCGCTCCGATTGCCTACTGATATTTTCTTTCAG
AGGAGATACGGGTGTCGAGCA
ATGATGCTTGAAACCGTGGCTGCGGTTCCTGGAATGGTTGGAGGAATGCTTCTTCACTGTAAATCCCTTAGGCGGTTCGAGCACAGTGGTGGATGGATCAAAGCGCTGTTAGAAGAAGCT
GAGAATGAGAGAATGCACTTAATGACTTTCATGGAGGTTGCTAAGCCGAAATGGTATGAGCGCGCTCTTGTGTTCACTGTTCAGGGCATATTCTTCAATGCCTACTTTCTTGCGTACCTT
GCTTCGCCTAAGTTGGCTCACCGGATCACTGGGTACCTTGAGGAAGAAGCAATCCACTCGTACACTGAGTTCTTGAAGGAGCTTGACAAAGGCAACATAGAAAATGTTAAGGCGCCAGCC
ATTGCTATTGACTATTGGCGTCTTCCAGCTGATTCGACGCTTCGTGATGTTGTTATGGTTGTGAGAGCAGATGAGGCCCATCATCGTGATGTTAATCACTTTGCTTCG
GACATACATTAC
CAAGGACTCGAGCTTAAGGATTCTCCGGCTCCAATCGGATATCAC

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCACCGCCAT ACTTTCTACA CCATATAAAA CCCATAAACC CTTAAACCCT TCTCCAAGTA AAATCAACTG TCACAGAAAA AAAAGATATT CACACAAATT CTCAATTCAC TTACATTTCC  AATTTTCTTG CAACAAACAT TTTCAAAAGT GTTATCAACG AAGATGATGA GTCGCGGATC AACAACTGTT GTCCGATCCG TTCGGCTATT CTCAACCGGT TCCGTGATCC GCCCGGTTCG  AACCGGTGGA TCTGAAAAGG CGGTGGTGAC GTCGTGGATT AGATCGTATT CGGTGGCTGG TGGTCGCAAT GCGAGTACAA TGACGTTGGG GGAGAAAGAA GTGAAAGAAC AGCCGGATAT  TAAGGATACG GTGGCCGGCG GTGGTGCAGC CGCCGGAGGT GAGAAAGAGA AAGAGGTGGT GAGTTATTGG GGAGTGCAAC CGTCGAAAGT TACGAAAGAA GATGGTACTG AGTGGAAGTG  GAATTGTTTT AGGCCATGGG AGACGTATCA AGCGGATCTG TCGATTGATT TGAAGAAGCA TCATGTTCCG AAGACGTTTT TGGATAAGTT TGCGTACTGG ACTGTTAAGT CGCTCCGATT  GCCTACTGAT ATTTTCTTTC AGAGGAGATA CGGGTGTCGA GCAATGATGC TTGAAACCGT GGCTGCGGTT CCTGGAATGG TTGGAGGAAT GCTTCTTCAC TGTAAATCCC TTAGGCGGTT  CGAGCACAGT GGTGGATGGA TCAAAGCGCT GTTAGAAGAA GCTGAGAATG AGAGAATGCA CTTAATGACT TTCATGGAGG TTGCTAAGCC GAAATGGTAT GAGCGCGCTC TTGTGTTCAC  TGTTCAGGGC ATATTCTTCA ATGCCTACTT TCTTGCGTAC CTTGCTTCGC CTAAGTTGGC TCACCGGATC ACTGGGTACC TTGAGGAAGA AGCAATCCAC TCGTACACTG AGTTCTTGAA  GGAGCTTGAC AAAGGCAACA TAGAAAATGT TAAGGCGCCA GCCATTGCTA TTGACTATTG GCGTCTTCCA GCTGATTCGA CGCTTCGTGA TGTTGTTATG GTTGTGAGAG CAGATGAGGC  CCATCATCGT GATGTTAATC ACTTTGCTTC GGACATACAT TACCAAGGAC TCGAGCTTAA GGATTCTCCG GCTCCAATCG GATATCACTG AAGAAGAAAA TCAGTCTTTT ATGCGTAATA  AAGTTGGTTC TATGATTACC TTGTAAAGAT TTTATGTTGG TTTTGGGGTG TTGTACCTGC CTCTATTTCC ATGAGATTTG TCTTTCAAGA CTGGTTTCGG TTTTGAATGA GATCAAATGG  AAGTTTCTAA TTGAGGGTAT AACTTGTGTC TACTGTTGGT TTAAACAACT GATTGATGGT AAGTTGTAAG AAATGGACGA CGGAATTACA ATTGTTGCAA CATTTTCTGT TTGAAAGTGA  AGGATTGGTT TTGCAAGTGT TGCAACATAA CTTCTTTTAT GTGGCATGAT GATGCATCAT AAGTTATCAA TGGGTTGGTT ATTAAGAGCA GGGGTTTCAA TGACGCGCGT TGCGCGAAAG 
ATATTGGTGT TTTCGACCGA CATCATCCTG CAACTCTTCT TGTAACTGTT TCACTTTTTG CAAAGACTGA ACGTAGACCC TA 

Retrieve as FASTA