Entry information : HaAOX02(HanXRQChr03g0081321/AOX1A)
Entry ID 13682
Creation 2016-05-12 (Christophe Dunand)
Last sequence changes 2016-05-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2019-07-24 (Christophe Dunand)
Peroxidase information: HaAOX02(HanXRQChr03g0081321/AOX1A)
Name HaAOX02(HanXRQChr03g0081321/AOX1A)
Class Alternative Oxidase    [Orthogroup: AOX001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaAOX02
start..stop
S start..stop
HaAOX01 607 0 1..312 1..335
HaAOX04 538 0 1..312 1..342
ThasAOX02 511 0 16..312 29..336
AtAOX03 507 0 24..312 51..354
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 130199319..130199579 261 N° 2 130198664..130198792 129 N° 3 130195258..130195746 489 N° 4 130195104..130195160 57
complement(join(130195104..130195160,130195258..130195746,130198664..130198792,1 30199319..130199579))


exon

Literature and cross-references HaAOX02(HanXRQChr03g0081321/AOX1A)
DNA ref. HanXRQ genome:   HanXRQChr03 (130199579..130195104)
Protein sequence: HaAOX02(HanXRQChr03g0081321/AOX1A)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312
PWM (Da):   %s   35745.01  
PI (pH):   %s   8.43
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMSRGTTTVVRSARLSEKAVATWWIRSYSVAGGRNASTMMLGEKEQPDNKETVAGGEKEKEVVSYWGVQPSKVTKEDGTEWKWNCFRPWETYQANMSIDLKKHHVPKTFLDKFAYWTVKSLRLPTDIFFQRRYGCRAMMLETVAAVPGMVGGMLLHCKSLRRFEHSGGWIKALLEEAENERMHLMTFMEVAKPKWYERALVFTVQGIFFNAYFLAYLASPKLAHRITGYLEEEAIHSYTEFLKELDKGNIENVKAPAIAIDYWRLPADSTLRDVVMVVRADEAHHRDVNHFASDIHYQGLELKDSPAPIGYH

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGTCGCGGAACAACAACTGTCGTCCGATCCGCACGGTTATCTGAAAAGGCGGTGGCGACGTGGTGGATTAGGTCGTATTCAGTGGCTGGTGGTCGCAATGCGAGTACGATGATG
TTGGGGGAGAAAGAACAGCCGGATAATAAGGAGACGGTGGCCGGCGGTGAGAAAGAGAAAGAGGTGGTGAGTTATTGGGGAGTGCAACCGTCGAAAGTTACGAAAGAAGATGGTACTGAG
TGGAAGTGGAATTGTTTTAGG
GTATGTTTCTAGTTTGTTAATGATATATGAAGTTTTTTAGGGTTTATTGATCATTAATTCATAATAATATACTAGACAGTTATCTGATGATCTTAGAGC
TGTCCTCTCGAAAAAATTTTAACCTCTAATTGGACCCAAAATCGTAGTTAAGGGGAAATGAATTAAAAAATAAAACTTTAGTGGTCGAGTAAATACTTGAACTTGACCTGAAAACTCTCG
AAAATATTTAGGCCCCCAATTGGGCCCAAAATCGTAGTTAAGGGGAAATGGATTAAAAAATTAAACTTTAGTGGTGGAGCAATGACTTGAACTTGAGACGTGTATATCATCTTGAGATGG
TTTTTATCCACTACACTATCAACATTTTTTTATATAATAAACAGTTGAATATACTAAATATATAATTTAATAATAAATATATAAAAGTTTGTAAAGGCTTTTCGGGCCCTTTGAAAATTT
GGGCCTCGGGCGTCGGCACGGGTTGGCCGGCCCTGTCTGATCTGATTTGAGTGTTAATTAATTGTAGCCATGGGAGACGTATCAAGCGAATATGTCGATTGATTTGAAGAAGCATCATGT
TCCGAAGACGTTTTTGGATAAGTTTGCGTACTGGACTGTTAAGTCGCTCCGGTTGCCTACCGATATTTTCTTTCAG
GTCAACAACTTACTCTCTTCTCTAAATGGTTATAGATATTTTGG
TATGAAATGTATAGTAATGATAAGGTTACATGTTGGTATGCAATTGATATGTTAGTTTGGTGAAAAAAAATATATGTTTAGGTGGTTAATAGAGTTAATTACATGGTTAGTCCCTGTGGT
TTGCATAAAATAACATACTTAGGTACTAATAGTTTAAAATCACATTCTAGGGTATTAACTTTTCATTTTCTAACGTTTGGAGGTATTAACGTTATTTGTAGGTTTAAAATCACCTTCTAT
TAGTACCTAAGTATGTTATTTTGTGCAAACCACAAGGACTATGTTAATACCCTAGAAGTTAATACCTCCAAACGTTACAAAATGAAAAGCTAATACCCTAGAAGGTGATTTTAAACTATT
AGTACCTAAGTATGTTATTTTATGCAAACCACAGAGACTAACTATGTAATTAACTCATGATTATACAAAGTGTTTTTAGGTTTGTAGTTGTTTCTCTAGTAATTTTTAAGTTTTTAAAAA
AATTATATACATTTTTTTTCAACATTCTGGTATATTTGATTAAAATCAAGTTGATTCAAATAAATTATTTTTTGATGAAATAAATTAGTTTTATCATAACCTTTTTTTTATAAAATTTAT
GTGGGAATATCGGAAAAAAAAAAGTTAAAAACAAAAGTGTATATGTAGATTTTTTTGATTAAATATTAAAAGTTACTCAAGAAAAAATAAATTACGTGTTAAATGAATTGTTAGAAAAAA
TAATAAGAATAACCTTTTGACTTTGCTACTTTCCCAACAAGCAAATCACCTTCGAAATCTACAAACCCAAAAAACCACAAATCCTGAACCACTAAGACTAGAAGGTATGGTTCGGCTCAT
CCCCACGGGATGAGCCTCCACGTAGACGCCACGTATGCGGCTAGTGGGGGATGAGCCTCCATGAAGGATGGAGGGGGATGGAGGATGGGGCCCCACCACATATTTTTTTATTGTTTAATT
CATTTTATTTGTTTAACTTTTATTGTTTATTTTTTATTTGTTTAACTTTATAAAAACTATTCAACATTTAAATAAAAATAAGACATAAAGGAAGATAATAAAATTCATTACATAACATAA
ACAAAAATTACATAACCTAAAAAAAATTACGCTACCTAAAATTTGTAAAAAAAAGACTAGATTTAAAAATTTAAAACAATTACACTACTCGTCTTCGTCTCCGTCACCGTCCCCGATGTT
AACGTTATTCCAAATATGTTCTACCAAATCTTGTTGAAGGTTTGCATGCGTGATGTCGTTTGTTAGCGAGAACGAGTTTAAATCCTGTTGTGGCGGATCAACCGGGACAGTGTTCCGGTA
AGATGCATTCTCATCATACTCACAAATCGCCCGACCTTCGTCTTCAATAATCATGTTATGGAGCAAAATGCAAGCGTACATACAAAGACGCAACCTTTTCGGTGTGAACGCACGTGCCGG
TTGTGCAAGGATGGCCCATTTTTTTTGTAAGACACCAAAAGCACGTTCGATGTCTTTTCTTGCAGCTTCTTGACGCTTGGCGAATTTTTTCCTTTTTTCGTCCTCGGGATATGGAATAGT
CTTTACAATTGTAGACCAAGATGGATATATCCCGTCAGCAAGATAATACCCACGTCTATACTCAACCCCAGAAACTGTAAAACGTGTGTCCGGACCGGTTCCATTAACGACATCGGTAAA
GATCGCCGATTGGTATAACACGTTGAGGTCATTGAGTGAACCAGGGAGACCAAAGAAAGAATGCCATATCCACAAATCTTGTGATGCCACGGCTTCAAGTATCACGGTTGGATAGCCGTG
ATCACCTCGCGTATATTGGCCGCGCCACGCAGTCGGGCAATTATGCCACCCCCAATGCATACAATCAATGCTACCAAGCATTCCCGGAAACCCGTGCCTTGCTTCATGAGCTTGGTACAA
CTGTTGAACATCATACGCGTTTGGTTTCCGCAAATATTTTTTGCTATACAGTTTCACCACATTATCGCAAAACCGATACAAACATTCCCGCGTAGTTCTTGCCGACATCTGTAAGTACTC
GTCCAAAGCGTCGGCCACTGTCCCGTACGCCAGTTGGCGAATGGCCGCAGTACACTTTTGTAACGTGGTGAACCCTTCATAATTTCGAGCATCAGGTCGTTGCGTGAAAAACGGGTCTAG
CCCCGCCAAATCATTAGCAATCCGTGTGAATAAGCGGCGACTCATTCGGAACCTGCGCCTGAAAATGTCGGCGTTGTAAAGTGGTTCATCCGAAAAATAATCGTTCATCAATTTCTCGGG
CGCTCCTGTCGTATAAAATATATAAATACGAGTTAAAAAAATAAGGATAATGAAATTTTGTAATGAAAAACCTTGGCGGTCTCTGTTAATCCGTATTCGTCTGGTAATAACATTTTCAGA
CGAGAAGTCTTCCTCTTCCTCTTCCTCTTCAATTAGAATCTGTCCCGCCCGTAGCACAGCGTTTGCGAAAAACATCTCCTCTTCGTCATCCGAAGACGAGGGCCACCAAGGATTAGAAGC
CATTGTGGATGAAAAAAAGTGGGGAGAAAATGGTATAAAAGTGAGAGGGTTTTGGGTTGAAAGTGGGGAAATTATGGTGAAAATAGGTGATTTTATAGAAAAAGGAAATTTTTTTTTTTT
ATTAAATATTGCCGTTGAATAACGGCTAGTTTTCAAACTAGTGGATTGGCGGACCCGGCTGTGGGTCGCTGGGTGTGATGGGCCGAGCCCCAGGGGCGGTGTGGGGGACCGGCGCCGGGC
CTAGCCGGGCCTCAGCCGGCCCCCATACCTTCTAGTCTAAAAACGTCTTAATTTGATACCATATTTTTTCAATGGTTAATAGTTGTGCTAAAACTGATTTGATTATATAACAGAGGCGAT
ACGGTTGTCGTGCAATGATGCTTGAAACCGTGGCTGCGGTTCCTGGAATGGTTGGAGGGATGCTTCTTCACTGTAAATCACTAAGGCGGTTCGAGCACAGTGGTGGGTGGATCAAAGCGC
TGTTAGAAGAGGCTGAGAATGAGAGAATGCACTTAATGACTTTCATGGAGGTTGCTAAGCCGAAATGGTATGAGCGCGCTCTTGTGTTCACTGTTCAGGGCATATTCTTCAATGCCTACT
TTCTTGCGTACCTTGCTTCGCCTAAGCTGGCTCACCGGATCACTGGGTACCTTGAGGAAGAAGCAATCCACTCGTACACTGAGTTCTTGAAGGAGCTTGACAAAGGCAACATAGAAAATG
TTAAGGCGCCAGCCATTGCTATTGACTATTGGCGTCTTCCAGCTGATTCGACGCTTCGTGATGTTGTTATGGTTGTGAGAGCAGATGAGGCCCATCATCGTGATGTTAATCACTTTGCTT
CG
GTACTTGTTACACTTTCAGTTTTTAATGTGCTCTTTTATGCCAAATTTGATTTTATATATGCCATTTTATGACCTTTGTGTATTGAATATGTTGCAGGACATACATTACCAAGGACTC
GAGCTTAAGGATTCTCCGGCTCCAATCGGATATCAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGTCGCGGAACAACAACTGTCGTCCGATCCGCACGGTTATCTGAAAAGGCGGTGGCGACGTGGTGGATTAGGTCGTATTCAGTGGCTGGTGGTCGCAATGCGAGTACGATGATG
TTGGGGGAGAAAGAACAGCCGGATAATAAGGAGACGGTGGCCGGCGGTGAGAAAGAGAAAGAGGTGGTGAGTTATTGGGGAGTGCAACCGTCGAAAGTTACGAAAGAAGATGGTACTGAG
TGGAAGTGGAATTGTTTTAGG
CCATGGGAGACGTATCAAGCGAATATGTCGATTGATTTGAAGAAGCATCATGTTCCGAAGACGTTTTTGGATAAGTTTGCGTACTGGACTGTTAAGTCG
CTCCGGTTGCCTACCGATATTTTCTTTCAG
AGGCGATACGGTTGTCGTGCAATGATGCTTGAAACCGTGGCTGCGGTTCCTGGAATGGTTGGAGGGATGCTTCTTCACTGTAAATCACTA
AGGCGGTTCGAGCACAGTGGTGGGTGGATCAAAGCGCTGTTAGAAGAGGCTGAGAATGAGAGAATGCACTTAATGACTTTCATGGAGGTTGCTAAGCCGAAATGGTATGAGCGCGCTCTT
GTGTTCACTGTTCAGGGCATATTCTTCAATGCCTACTTTCTTGCGTACCTTGCTTCGCCTAAGCTGGCTCACCGGATCACTGGGTACCTTGAGGAAGAAGCAATCCACTCGTACACTGAG
TTCTTGAAGGAGCTTGACAAAGGCAACATAGAAAATGTTAAGGCGCCAGCCATTGCTATTGACTATTGGCGTCTTCCAGCTGATTCGACGCTTCGTGATGTTGTTATGGTTGTGAGAGCA
GATGAGGCCCATCATCGTGATGTTAATCACTTTGCTTCG
GACATACATTACCAAGGACTCGAGCTTAAGGATTCTCCGGCTCCAATCGGATATCAC

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACAGTCAAA AAAAAAACCC TTCATACAAA TTCTGCATTT CCAATTTTCT TGCAATTCAC ATTTTCCATA GTCTTATCAA CTGAGATGAT GAGTCGCGGA ACAACAACTG TCGTCCGATC  CGCACGGTTA TCTGAAAAGG CGGTGGCGAC GTGGTGGATT AGGTCGTATT CAGTGGCTGG TGGTCGCAAT GCGAGTACGA TGATGTTGGG GGAGAAAGAA CAGCCGGATA ATAAGGAGAC  GGTGGCCGGC GGTGAGAAAG AGAAAGAGGT GGTGAGTTAT TGGGGAGTGC AACCGTCGAA AGTTACGAAA GAAGATGGTA CTGAGTGGAA GTGGAATTGT TTTAGGCCAT GGGAGACGTA  TCAAGCGAAT ATGTCGATTG ATTTGAAGAA GCATCATGTT CCGAAGACGT TTTTGGATAA GTTTGCGTAC TGGACTGTTA AGTCGCTCCG GTTGCCTACC GATATTTTCT TTCAGAGGCG  ATACGGTTGT CGTGCAATGA TGCTTGAAAC CGTGGCTGCG GTTCCTGGAA TGGTTGGAGG GATGCTTCTT CACTGTAAAT CACTAAGGCG GTTCGAGCAC AGTGGTGGGT GGATCAAAGC  GCTGTTAGAA GAGGCTGAGA ATGAGAGAAT GCACTTAATG ACTTTCATGG AGGTTGCTAA GCCGAAATGG TATGAGCGCG CTCTTGTGTT CACTGTTCAG GGCATATTCT TCAATGCCTA  CTTTCTTGCG TACCTTGCTT CGCCTAAGCT GGCTCACCGG ATCACTGGGT ACCTTGAGGA AGAAGCAATC CACTCGTACA CTGAGTTCTT GAAGGAGCTT GACAAAGGCA ACATAGAAAA  TGTTAAGGCG CCAGCCATTG CTATTGACTA TTGGCGTCTT CCAGCTGATT CGACGCTTCG TGATGTTGTT ATGGTTGTGA GAGCAGATGA GGCCCATCAT CGTGATGTTA ATCACTTTGC  TTCGGACATA CATTACCAAG GACTCGAGCT TAAGGATTCT CCGGCTCCAA TCGGATATCA CTGAAGAAGA AAATCAGTCT TTTATGCGTA ATAAAGTTGG TTTTTGTCTA TGGTAAAAGT  GATGGTTCTA TGATTACCTT GTAAAGGTTT TATGTTGGTT TTGGGTTCGT TTCAGTGCTA ATTACAGAAA CCTTTATGGT GTTGTACCTG CCTCTATTTC CATGAGATTC GTCTTTGGGT  GTTTACGCAG AAATTCTTTA GCATTGTCTA CCAATCTGGC TAGACAGTGA ATCGTCATCG AGTTCATCTC TCAGCTGACT AAGGCTATGA TCGATTAGAT ATTCTTCACG AGGCCCCTTA  AAAACTTTTG GTTATCTATG ACTTTAAGGA GAGAGATGAC CTTTGAATCC AAAGAACTTG AGTAACTAAG ATTGAGCCGT GACATGAGAT TCTGTTTGAT ATTGGTAATG ACAGTTATAT  TTCTCGTATT TATAAACATC TAAAGAACGA GAATGTATCC TTGGTCAAAA GAAAGTGGTA AATTCCTCTG TTAAACAAAC AAAATGAATC CGTGGTCTAA CCAACACTAT GATTGGGTTG  AGACGTTGCA AGTTTTCGTG AAATAGTACA GCAGTTGACG GTTATAACTT TGCTCAGTTG TAGTTGTATC AGGGAAAACC TAAGTAGAAA TATCATTAGA GTTGCTACTG CTCTAAGTTA 
GTACTAAGGG GACACGGGGC GGTAGCTTAT AACGCGTGGA AGTTTATTTT TCCCACCCCG CCTCATTTAG ATAACG 

Retrieve as FASTA