Entry information : HaPTOX03 (HanXRQChr05g0129171)
Entry ID 13683
Creation 2016-05-12 (Christophe Dunand)
Last sequence changes 2016-05-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPTOX03 (HanXRQChr05g0129171)
Name (synonym) HaPTOX03 (HanXRQChr05g0129171)
Class Plastid Terminal Oxidase    [Orthogroup: PTOX001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPTOX03
start..stop
S start..stop
ThasPTOX01 467 1e-166 2..336 6..360
AtPTOX01 449 6e-160 45..333 54..351
PpaPTOX02 370 8e-128 31..326 60..374
MpPTOX02 360 3e-124 65..326 83..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1415047..1415156 110 N° 2 1414377..1414569 193 N° 3 1414209..1414302 94 N° 4 1413240..1413355 116
N° 5 1412539..1412647 109 N° 6 1412364..1412432 69 N° 7 1412213..1412284 72 N° 8 1412097..1412144 48
N° 9 1411823..1412019 197  
complement(join(1411823..1412019,1412097..1412144,1412213..1412284,1412364..1412 432,1412539..1412647,1413240..1413355,1414209..1414302,1414377..1414569,1415047. .1415156))


exon

Literature and cross-references HaPTOX03 (HanXRQChr05g0129171)
DNA ref. HanXRQ genome:   HanXRQChr05 (1415156..1411823)
Protein sequence: HaPTOX03 (HanXRQChr05g0129171)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336
PWM (Da):   %s   39145.48 Transmb domain:   %s   o183-202i
PI (pH):   %s   6.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVASFLPSIFSPSTNLLLLRGSRSFSPTSIAHFHSRRRRRRLCKVRATILRENEKVAVEETFQPKTSPDDHNNNNNEPPPPGSVEKWVIKLEQSINIFLDSVIKVLDTLYHDRDYPRFFVLETIARVPYFAFISVLHMYESFGWWRKSEYLKVHFAESWNEMHHLLIMELGGNAWWFDRFLAQHIAIFYYFMTVFMYALSPRMAYHLSECVESHAFETYDKFIKEKGDELKKLAPSKVAVKYYTEEDLYLFDEFQTARLPNTRRPIIQNMYDVFMNIRDDEAEHCKTMKACQTHGNLRSPHASEDDDLGCTLPDAGCEGIVDCIKKSITNPP

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGTGGCTTCTTTTCTTCCTTCGATTTTCTCTCCCTCTACAAACCTCCTCCTCCTAAGAGGGAGTCGTTCCTTTTCTCCTACGTCAATCGCTCATTTCCATTCCAGGTACCTTTTT
TTATTTATTTAGTACCCAACCCACTTGTTTCATGATATTCCCTTGAATTGGACAATATAATATAGTTTGTTTGTTGAATTATATACAAGTAGTTGTTCTGTTCTTGATTTTGGAAAAAAA
TTCATTGGATTTTGAAACCAGCCAAGCCGTCGTCGTTTTGATCAAAAGCGATTGATGAAAGGGGATTTTGAAATTGCAATTGTTTCTGTCTGATGCAAGGTCTTGATCGATCACTGATAT
ATAACAAGGGATAGGTTATCACATCACCTTGTTTATAAGTTTTCATCCCTCCTCCTCCTCATCTCTTACTCAACTACAAATCTCAACCTTTCCATCGATTCATTACTTCAACCCTTACTA
CTTTGTTAACAACACTCATCCTCAGATTTGTTTTTAATTATTTCAGAGGGTATTTACCTCGAATTCTGTTGAATTTCATTACGGACAGTTTATTGATCCTTTTGTAGGAGGAGGAGGAGG
AGGCTGTGTAAGGTCCGAGCAACCATTTTGCGAGAAAATGAGAAAGTGGCTGTGGAAGAAACATTTCAACCCAAGACTTCTCCTGATGATCATAATAACAACAACAACGAGCCGCCGCCC
CCAGGCTCTGTCGAGAAATGGGTCATAAAGCTTGAACAATCTATAAACATTTTTCTTACG
GTATATTTATTATCTTTGGATACTTACGGGAGAAGTGATCCATCGTGTTTAAACCACATT
TGCTCTCTTTTCAGGATTCAGTAATCAAAGTCCTTGACACATTGTACCATGACAGAGACTATCCAAGGTTTTTTGTTCTCGAAACAATAGCAAGAGTCCCTTACTTTGGTAAGTCTTTAT
TTCACCTCTCACCACTTTTAAACCAATCACGTCTTTAGGTCTCTTTTGATGTTTTGCTACTAGTAGTATTTATTTATTGCAGTGGAGGACCAACAACATGTATATTTAAAGGGAAAGGGA
TGTTTAATACACTTAGGAATTGTTAGGTTAGGTAGATGCATATTCATAATTTATTCTTGTTAGTGATGTGTAGGGCTGTAAACGAACCAAACAAGACCTTGTTCATGTTCGTTTGTTAAG
AAATATATGTGTTCGCGAACCGTTCACGAACACTTATCGAACGAGATTTTGTGTTCGTGTTCGTTTGTTAAGGAAATGAACTTGTTCGTGTTCGTTTGTGTTTGTTTGTTAATTTTTGGC
AACGAACGTTGACGAACACAAATGAGCACAAACTAATGTTCATGAACACAAATGGAAACAAACGAACACAAACAATCGTTCATGAACATAATATATAATACACCGACACTTATTAAGTAT
TTAATTTGTCGGAATTTTGACGTATTTAAATAAATATAAAAACTAAAAACACTAATGAAGTATCGAACACAAACGAACATGTTACCGAATGTTCACGAACATAAACGAACGAACACGACC
TCTGTTCATGTTTGTTCATTTAACTAAACGAACGAAATTTCTTGTTCATGTTCGTTTGTTTAATAAACGAACGAACACAAATGAACTTCCCGCCGAACGGTTCACGAACTGTTCGCCAAA
CGTTTGGTTCGTTTGCAGCCCTAGTGATGTGGGCTACACCGGTCTGTGACTCTATGCTACTGTAAAACTATGGTGGCTGTTAATTTCAGGCATATAACGGTTGTCTTTGGTTTTACTGCA
GCTTTTATATCTGTTCTTCACATGTACGAGAGTTTTGGTTGGTGGAGAAAATCAGAGTATCTGAAAGTCCACTTTGCTGAGAGCTGGAACGAGATGCATCATCTGCTTATTATGGAAGTA
ATCTTCTTCTCCGCATATCTCTCTTACGTATTGAACTACTTCTTTTACATATGCATGCATTCTAAAATAAATTCCCTTCTATCTCTAAAGTTCAGTTTCAATCATCAGTTAGTTAGTCCA
TTGATTCTGTCATTCTTTGTTTTTATGGTTCTTTATTCTGGTAATTTATGGTTATAATCAAGTGATATTGTTATTTGGACAGGAATAAGATAAACCTAAATCCTAAACTCAAATATATAC
ACTATATTAGTGACAATATAGGCTTGTCTTCAGCAACTGTATATGCTAATACTGCCTCTGTATTTGTTCTTTTTATTCTATTCCTAAAAATTACAAAAAATATATTATTGCTGTTTTATC
TGTTACTCATTTATGAATTGAATTATTTATTATATTTAAAAATAAAACTATCTAGCATTATTTTCAAGGTTAGATGTACATGTAACTTTTGTAGTGTTTGAGGTCTCAAGACCATGCAGG
AGCGGGGTTATTGTTTTTGATATATACAGAAATTATGTGTGTGTGCATTGTATCATATTTACCCGTGATTTTTGGCTAATTATATGTCATTTGCAATTTATTGTTGCAGGAGTTGGGGGG
AAATGCTTGGTGGTTTGACCGGTTCCTTGCTCAACATATTGCAATCTTCTATTATTTCATGACAGTGTTCATGTATGCTTTAAGCCCAAGAATGGCAT
GTGAGTATGAACAGTTATTTGC
TTGAATGGCTTGCTCAGTGGAAAGTTAGTTAGTTAGTTTAACACCAATTTTGTCTGATTCATGTGTTGGTTGATTCTCACACAGATCATCTTTCTGAATGTGTGGAGAGCCATGCATTTG
AAACCTATGACAAATTTATCAAGGAAAAAGGAG
GTATGCTTCTTTATTAATTAATTAATAAATAAATCACAATAACACCCAATTTATGATGTGCTTGCTTGCTTGGGAACAGATGAATTA
AAGAAGCTTGCTCCCTCTAAAGTTGCTGTGAAATACTACACAGAAGAAGATTTGTATTTGTTTG
GTAAGTCCCACTTTAGCTACATCATCTATTTTTTTTTTTTGTATAACCGTTTCAAC
ATCTCTATTCAGATGAATTTCAAACCGCAAGGCTTCCCAATACTCGAAGGCCAATAATACGTAAGATTAGAAACACCCCAAATGTCTTTTATTTGATTTGATACAAAGGATTGTGCTTAT
TGTTTTGTTATGTCCAGAAAATATGTATGATGTGTTTATGAACATTAGAGACGATGAAGCAGAACACTGCAAGACAATGAAAGCATGTCAGACTCATGGGAACCTTCGTTCTCCTCATGC
ATCTGAAGATGATGATTTAGGTTGTACACTACCCGATGCAGGATGTGAAGGTATTGTAGATTGTATAAAGAAATCTATTACAAATCCACCCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGTGGCTTCTTTTCTTCCTTCGATTTTCTCTCCCTCTACAAACCTCCTCCTCCTAAGAGGGAGTCGTTCCTTTTCTCCTACGTCAATCGCTCATTTCCATTCCAGGAGGAGGAGG
AGGAGGCTGTGTAAGGTCCGAGCAACCATTTTGCGAGAAAATGAGAAAGTGGCTGTGGAAGAAACATTTCAACCCAAGACTTCTCCTGATGATCATAATAACAACAACAACGAGCCGCCG
CCCCCAGGCTCTGTCGAGAAATGGGTCATAAAGCTTGAACAATCTATAAACATTTTTCTTACG
GATTCAGTAATCAAAGTCCTTGACACATTGTACCATGACAGAGACTATCCAAGGTTT
TTTGTTCTCGAAACAATAGCAAGAGTCCCTTACTTTG
CTTTTATATCTGTTCTTCACATGTACGAGAGTTTTGGTTGGTGGAGAAAATCAGAGTATCTGAAAGTCCACTTTGCTGAGAGC
TGGAACGAGATGCATCATCTGCTTATTATGGAA
GAGTTGGGGGGAAATGCTTGGTGGTTTGACCGGTTCCTTGCTCAACATATTGCAATCTTCTATTATTTCATGACAGTGTTCATGTAT
GCTTTAAGCCCAAGAATGGCAT
ATCATCTTTCTGAATGTGTGGAGAGCCATGCATTTGAAACCTATGACAAATTTATCAAGGAAAAAGGAGATGAATTAAAGAAGCTTGCTCCCTCTAAA
GTTGCTGTGAAATACTACACAGAAGAAGATTTGTATTTGTTTG
ATGAATTTCAAACCGCAAGGCTTCCCAATACTCGAAGGCCAATAATACAAAATATGTATGATGTGTTTATGAACATT
AGAGACGATGAAGCAGAACACTGCAAGACAATGAAAGCATGTCAGACTCATGGGAACCTTCGTTCTCCTCATGCATCTGAAGATGATGATTTAGGTTGTACACTACCCGATGCAGGATGT
GAAGGTATTGTAGATTGTATAAAGAAATCTATTACAAATCCACCCAAC

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACGATTTTAT AAAAATCTAG CACTCCTCCC TTTTCAATTT TTAAGATTTC AGGTTCACCA AGCAGTGCAG GCGCAGTTTG TTATGGCGGT GGCTTCTTTT CTTCCTTCGA TTTTCTCTCC  CTCTACAAAC CTCCTCCTCC TAAGAGGGAG TCGTTCCTTT TCTCCTACGT CAATCGCTCA TTTCCATTCC AGGAGGAGGA GGAGGAGGCT GTGTAAGGTC CGAGCAACCA TTTTGCGAGA  AAATGAGAAA GTGGCTGTGG AAGAAACATT TCAACCCAAG ACTTCTCCTG ATGATCATAA TAACAACAAC AACGAGCCGC CGCCCCCAGG CTCTGTCGAG AAATGGGTCA TAAAGCTTGA  ACAATCTATA AACATTTTTC TTACGGATTC AGTAATCAAA GTCCTTGACA CATTGTACCA TGACAGAGAC TATCCAAGGT TTTTTGTTCT CGAAACAATA GCAAGAGTCC CTTACTTTGC  TTTTATATCT GTTCTTCACA TGTACGAGAG TTTTGGTTGG TGGAGAAAAT CAGAGTATCT GAAAGTCCAC TTTGCTGAGA GCTGGAACGA GATGCATCAT CTGCTTATTA TGGAAGAGTT  GGGGGGAAAT GCTTGGTGGT TTGACCGGTT CCTTGCTCAA CATATTGCAA TCTTCTATTA TTTCATGACA GTGTTCATGT ATGCTTTAAG CCCAAGAATG GCATATCATC TTTCTGAATG  TGTGGAGAGC CATGCATTTG AAACCTATGA CAAATTTATC AAGGAAAAAG GAGATGAATT AAAGAAGCTT GCTCCCTCTA AAGTTGCTGT GAAATACTAC ACAGAAGAAG ATTTGTATTT  GTTTGATGAA TTTCAAACCG CAAGGCTTCC CAATACTCGA AGGCCAATAA TACAAAATAT GTATGATGTG TTTATGAACA TTAGAGACGA TGAAGCAGAA CACTGCAAGA CAATGAAAGC  ATGTCAGACT CATGGGAACC TTCGTTCTCC TCATGCATCT GAAGATGATG ATTTAGGTTG TACACTACCC GATGCAGGAT GTGAAGGTAT TGTAGATTGT ATAAAGAAAT CTATTACAAA  TCCACCCAAC TAATGAACAC ACGTGTATAT AATAATAAAG ATATAAGAGA AGTATTCAAT TAACATATAC AAGTTGTATG GCTAAACGCA GAAGAAGCCA GTTTGATCTT GCGGTGAATT  GTTGTAGTAT GTAAAAGGGT GTTTTATAGA TTTTAGTTTC GGACTGATGT TTTTAAGACT TTGCAGAAGT TAGTTGAAAT GGAAATGTGA GGAAGTATAC AAACATACGC TTTATATATA 
GTTTTGCAAT GTCATCTTTT TTAATTTTAG ATGATATGCA TATAAAAACT ATGTTAATTT TTATCTTCAG TTGAGTTTGA 

Retrieve as FASTA