Entry information : HaAOX06 (HanXRQChr16g0514271)
Entry ID 13686
Creation 2016-05-12 (Christophe Dunand)
Last sequence changes 2016-05-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaAOX06 (HanXRQChr16g0514271)
Name (synonym) HaAOX06 (HanXRQChr16g0514271)
Class Alternative Oxidase    [Orthogroup: AOX002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaAOX06
start..stop
S start..stop
ThasAOX05 476 2e-170 1..344 1..340
AtAOX05 468 4e-167 55..344 65..353
HaAOX02 446 6e-159 77..344 45..312
HaAOX01 441 8e-157 89..344 80..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 97564389..97564745 357 N° 2 97566119..97566247 129 N° 3 97566334..97566822 489 N° 4 97567035..97567091 57
join(97564389..97564745,97566119..97566247,97566334..97566822,97567035..97567091 )


exon

Literature and cross-references HaAOX06 (HanXRQChr16g0514271)
DNA ref. HanXRQ genome:   HanXRQChr16 (97564389..97567091)
Protein sequence: HaAOX06 (HanXRQChr16g0514271)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344
PWM (Da):   %s   38982.78 Transmb domain:   %s   o170-192i227-249o
PI (pH):   %s   8.33
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNRLLANSVLRRCVMNGGRIMTGEHVVQSPEFAAAAVFSFRPFDRSVMVADQDFGSFQWRRMMCSAAEPAAKAPAVKQADAGAAKKEGEDQVAVSSYWGISRSKITREDGSEWPWNCFMPWDTYESNLSIDLSKHHVPKNFVDKFAFRTVKLMRIPTDIFFKRRYGCRAMMLETVAAVPGMVGGMLLHLRSLRKFQQSGGWIKALLEEAENERMHLMTMVELVKPKWYERLLVLTVQGVFFNAFFVIYVLSPKLAHRIVGYLEEEAVHSYTEFLKDIESGAIENVPAPAIAIDYWRLPKDSTLKDVITVIRADEAHHRDVNHFASDIHFQGKELRDAPAPVGYH

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATCGATTGCTTGCGAATTCGGTTTTGAGGCGGTGTGTAATGAACGGCGGCCGGATTATGACTGGAGAACACGTGGTACAGTCGCCGGAGTTTGCTGCAGCGGCGGTGTTTAGTTTC
CGGCCGTTTGATCGGTCGGTAATGGTGGCGGATCAGGATTTCGGGAGCTTTCAGTGGCGGAGGATGATGTGCTCTGCGGCGGAGCCGGCGGCAAAGGCGCCGGCGGTAAAACAGGCGGAT
GCCGGAGCTGCGAAGAAGGAAGGTGAAGATCAGGTTGCGGTTTCGAGTTATTGGGGGATTTCGAGATCTAAAATTACTAGAGAGGATGGTTCTGAGTGGCCGTGGAACTGTTTTATG
GTA
ATTTAATTGTTGTTTACGTATTTTGATATTTACTTACGGTATGTCGATTGTTTAATTGCTTATAGTTGTTACGGTTGATCGATTGAACGCTCATGTTTCTAAGATCTCTACGAATTGTTG
ATTGTTTTGATAGATTAACTGATCATCTAGAGATCACTACGGCATGAATGCATGATGATTTTGTTTCATGCGTTTAGAATTTGCTTTAACCTCGCAGAAACTGGTTATTAAACTCTGAAT
AATCAAATTGCTGTTTACTTAAATTGATATTTGTTTCAGTTTTGTTGACTATTTGATTGCTTATAGTTCTTACGTTTGCATGATTGGACTCTTGTGTTTCTGAGATCTAGACGAATTGTT
TATTGTTTTGATAGATTAACATATCATCACTGAATAATGATTTTGTTTTATGCTTTCAGAATTTGTTATATCATCTGTAGAAATCCCTTATTAAATGCTGCGTAATTAAATTGTTGTTTA
CTCAATTTGATATTTGTTTTAGTTTTGTTGACTGTTTGATTGCTTATAGTTAATACGGTTGCATATTGCTTATAGTTCTTACGGTTGCATATTGCTTATAGTTCTTACGGTTGCATATGA
TTGAACACTCATGTTTTTTATATCTCGACGAATTGTTGACTGTTTTGATAGATTAATAGATCATCACTGCATAATGATGTTTTATGTTTTCAGAATTTGGTTTAAAATCTCGGTAGAAAC
TTCCTATTTAATGCTGCATGATTAAATTAATGTTTACTTAATTTGATATGTGTTTCTGTTTTGTTACTGTTTAGTTCTTATGGTTGAATGATTGAATACTCATGTTTCTGAGATCTCGAC
GAATCGTTTATTGTTCTGATAGATTAAGAGATGACCTAGAGATCACTACTGCATGATGATTGTCTGTTAGAAAGTAGAAACTCCATATTAAATGCCCTGAGAAATTAGAAACTCCATATT
AAATGCCCTGCGAAATTTTATTTGGTGACTGAGATATCTGTGGAACTTCCTGTTGCTTTCTGAATTTATAAATTTGCTAAATTATTCGTTATCTAGGTCCCACCTGTGGGTTTAGACCCC
TGAAATATGAATGGCTTCAAAAAAGACATTGATGAATATGACAAGTCTTTTTTTTCTTTATAAATAGTTTTGTATATTTATTCCTAATCACCTATATTGGATGGCAATTAAAGATTTATT
AGATGAAATGGGTTACATAATTTTATTTTTATGAAAAGTTCTGATTTCAGACCAGATATAGGTTGACCCGCACCTGTCTTTTGGGCATATAATGTTAGGTATACGACTTTAGAGCCATTT
CATTTCTGAAATTTGACTATCTCCTGATTGTGTACTATCTTGTTTTGTAGCCGTGGGATACTTACGAATCGAACTTGTCAATCGATCTCAGTAAGCACCATGTACCGAAGAACTTCGTGG
ATAAATTTGCTTTCAGGACAGTGAAACTGATGAGAATTCCAACTGATATATTTTTCAAG
GTATCTTTCATCCTTATGATATTATGCTAATGTTTATCATTAGTTAATTATCTGTTTACTG
AAGTCCCAAATTTATGTTTATTCAGAGGCGGTACGGGTGCCGAGCAATGATGCTTGAAACTGTAGCAGCAGTCCCCGGGATGGTGGGAGGAATGCTACTGCACTTGAGATCTCTACGCAA
GTTCCAGCAAAGTGGAGGTTGGATCAAAGCATTGCTTGAAGAAGCTGAGAATGAAAGGATGCACCTCATGACAATGGTGGAGCTCGTGAAACCCAAATGGTATGAACGCCTTCTGGTTCT
AACCGTGCAGGGCGTTTTCTTCAACGCCTTCTTTGTTATATACGTATTATCCCCGAAACTAGCGCACAGAATCGTTGGGTATCTTGAAGAAGAAGCAGTACATTCATACACCGAGTTTCT
CAAGGACATTGAAAGTGGTGCAATTGAAAATGTTCCGGCCCCTGCTATCGCGATCGACTATTGGAGATTGCCGAAAGATTCTACCTTGAAAGATGTCATAACTGTTATCCGAGCTGATGA
AGCTCATCATCGTGATGTCAACCATTTTGCTTCT
GTAAGTCCCATTTCCTTTTAACCAACATTTTTCTATCTTAGTTCCTGGGAACCACATAAACACTTGTACAAGTTGTTTATGTAGTT
CCGTATGTAAAATTGGATCCATGTTGAACGACCCTGTTTATAAATAAAACATGACCCGAATTGAACCATCATATGTAAGTAAACGGGTTACGGGCCACCAGTAGTTGAGGTTTGTTATTA
TTGCAGGATATCCATTTCCAGGGTAAGGAATTGAGGGACGCTCCAGCACCTGTGGGTTACCAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATCGATTGCTTGCGAATTCGGTTTTGAGGCGGTGTGTAATGAACGGCGGCCGGATTATGACTGGAGAACACGTGGTACAGTCGCCGGAGTTTGCTGCAGCGGCGGTGTTTAGTTTC
CGGCCGTTTGATCGGTCGGTAATGGTGGCGGATCAGGATTTCGGGAGCTTTCAGTGGCGGAGGATGATGTGCTCTGCGGCGGAGCCGGCGGCAAAGGCGCCGGCGGTAAAACAGGCGGAT
GCCGGAGCTGCGAAGAAGGAAGGTGAAGATCAGGTTGCGGTTTCGAGTTATTGGGGGATTTCGAGATCTAAAATTACTAGAGAGGATGGTTCTGAGTGGCCGTGGAACTGTTTTATG
CCG
TGGGATACTTACGAATCGAACTTGTCAATCGATCTCAGTAAGCACCATGTACCGAAGAACTTCGTGGATAAATTTGCTTTCAGGACAGTGAAACTGATGAGAATTCCAACTGATATATTT
TTCAAG
AGGCGGTACGGGTGCCGAGCAATGATGCTTGAAACTGTAGCAGCAGTCCCCGGGATGGTGGGAGGAATGCTACTGCACTTGAGATCTCTACGCAAGTTCCAGCAAAGTGGAGGT
TGGATCAAAGCATTGCTTGAAGAAGCTGAGAATGAAAGGATGCACCTCATGACAATGGTGGAGCTCGTGAAACCCAAATGGTATGAACGCCTTCTGGTTCTAACCGTGCAGGGCGTTTTC
TTCAACGCCTTCTTTGTTATATACGTATTATCCCCGAAACTAGCGCACAGAATCGTTGGGTATCTTGAAGAAGAAGCAGTACATTCATACACCGAGTTTCTCAAGGACATTGAAAGTGGT
GCAATTGAAAATGTTCCGGCCCCTGCTATCGCGATCGACTATTGGAGATTGCCGAAAGATTCTACCTTGAAAGATGTCATAACTGTTATCCGAGCTGATGAAGCTCATCATCGTGATGTC
AACCATTTTGCTTCT
GATATCCATTTCCAGGGTAAGGAATTGAGGGACGCTCCAGCACCTGTGGGTTACCAC

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGAAACAGT AGACCGCGAA GCAGGTGATC GATTCTCAAA ATAATACAGT TATTGTGACT ATTCTGTTCA GTTTCTTCAA ATAAATACCG ACTGAAAGAA GTGTGTAGAC AGAACGATCT  GAAACCCTAA AAACGGTTAC AAAATGAATC GATTGCTTGC GAATTCGGTT TTGAGGCGGT GTGTAATGAA CGGCGGCCGG ATTATGACTG GAGAACACGT GGTACAGTCG CCGGAGTTTG  CTGCAGCGGC GGTGTTTAGT TTCCGGCCGT TTGATCGGTC GGTAATGGTG GCGGATCAGG ATTTCGGGAG CTTTCAGTGG CGGAGGATGA TGTGCTCTGC GGCGGAGCCG GCGGCAAAGG  CGCCGGCGGT AAAACAGGCG GATGCCGGAG CTGCGAAGAA GGAAGGTGAA GATCAGGTTG CGGTTTCGAG TTATTGGGGG ATTTCGAGAT CTAAAATTAC TAGAGAGGAT GGTTCTGAGT  GGCCGTGGAA CTGTTTTATG CCGTGGGATA CTTACGAATC GAACTTGTCA ATCGATCTCA GTAAGCACCA TGTACCGAAG AACTTCGTGG ATAAATTTGC TTTCAGGACA GTGAAACTGA  TGAGAATTCC AACTGATATA TTTTTCAAGA GGCGGTACGG GTGCCGAGCA ATGATGCTTG AAACTGTAGC AGCAGTCCCC GGGATGGTGG GAGGAATGCT ACTGCACTTG AGATCTCTAC  GCAAGTTCCA GCAAAGTGGA GGTTGGATCA AAGCATTGCT TGAAGAAGCT GAGAATGAAA GGATGCACCT CATGACAATG GTGGAGCTCG TGAAACCCAA ATGGTATGAA CGCCTTCTGG  TTCTAACCGT GCAGGGCGTT TTCTTCAACG CCTTCTTTGT TATATACGTA TTATCCCCGA AACTAGCGCA CAGAATCGTT GGGTATCTTG AAGAAGAAGC AGTACATTCA TACACCGAGT  TTCTCAAGGA CATTGAAAGT GGTGCAATTG AAAATGTTCC GGCCCCTGCT ATCGCGATCG ACTATTGGAG ATTGCCGAAA GATTCTACCT TGAAAGATGT CATAACTGTT ATCCGAGCTG  ATGAAGCTCA TCATCGTGAT GTCAACCATT TTGCTTCTGA TATCCATTTC CAGGGTAAGG AATTGAGGGA CGCTCCAGCA CCTGTGGGTT ACCACTAAAC CGTTTGCTTA TAGAGGAGGT  ATAGGATTCT GGTGGTATGG GTGCTTCAGT CAGTCAAACA AATAAGCATT TGTACAGTGA TATGAACTAG CATTTAAGCA CGATTAATAT GGTCGTGTGT TACCTCTGTC AAAATGATGT  GGATTCGACA TGTTTTGCAT AAAATAAGTT TACATTTGCG TGTGCCGAAA GCTAATAATA GTTGTACAAA TATTGAGAAG CAATATGACC GACTTTTTTT TTTTTTTTAC CAAGTGTCGA  TAATGGTTCA AAATGAGTTA AGTTTGAGAC ACGTGTTTAT AAGTGTGATT CAAACATGCC TGGTTGATCC GACTAACTTC ATTTTTTATG CACAATTATT GGATAAAAGA GTTGAAACAA  ACCATATTAT TAAAATAATG AGGTCATTTC TATAGATAAA GTGATAAACC GATTTAAAAG GTTATAATCT ATATAATTGG ATAGTAGCAT GTGTTGTCTG TATTTATTTT GCTATAAATA 
CATATCTATA TAACGAGTCT CCCGGGATAT TGTTTAAGAA AAATAACCGA GTGTGTGTTA AGAGTGAGAG AGCCGATCCT TAAACCTGTA GTTGAAG 

Retrieve as FASTA