Entry information : AtAOX03 (AT3G22370/AOX1A/ATAOX1A)
Entry ID 13689
Creation 2016-05-12 (Christophe Dunand)
Last sequence changes 2016-06-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-29 (Christophe Dunand)
Peroxidase information: AtAOX03 (AT3G22370/AOX1A/ATAOX1A)
Name (synonym) AtAOX03 (AT3G22370/AOX1A/ATAOX1A)
Class Alternative Oxidase    [Orthogroup: AOX001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtAOX03
start..stop
S start..stop
ThasAOX04 574 0 1..354 3..365
ThasAOX02 558 0 24..354 2..336
AtAOX02 531 0 34..354 15..325
HaAOX01 518 0 2..354 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..387 387 N° 2 470..598 129 N° 3 899..1387 489 N° 4 1468..1527 60
join(1..387,470..598,899..1387,1468..1527)


exon

Literature and cross-references AtAOX03 (AT3G22370/AOX1A/ATAOX1A)
Omic ref. AtProteome:   At3g22370 ATTED-II:   At3g22370 e-FP Browser:   At3g22370 TAIR:   At3g22370
Protein sequence: AtAOX03 (AT3G22370/AOX1A/ATAOX1A)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355
PWM (Da):   %s   39954.27  
PI (pH):   %s   8.71
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMITRGGAKAAKSLLVAAGPRLFSTVRTVSSHEALSASHILKPGVTSAWIWTRAPTIGGMRFASTITLGEKTPMKEEDANQKKTENESTGGDAAGGNNKGDKGIASYWGVEPNKITKEDGSEWKWNCFRPWETYKADITIDLKKHHVPTTFLDRIAYWTVKSLRWPTDLFFQRRYGCRAMMLETVAAVPGMVGGMLLHCKSLRRFEQSGGWIKALLEEAENERMHLMTFMEVAKPKWYERALVITVQGVFFNAYFLGYLISPKFAHRMVGYLEEEAIHSYTEFLKELDKGNIENVPAPAIAIDYWRLPADATLRDVVMVVRADEAHHRDVNHFASDIHYQGRELKEAPAPIGYH*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATAACTCGCGGTGGAGCCAAGGCGGCGAAATCGCTGTTAGTGGCGGCTGGACCACGTTTGTTCTCGACGGTCCGTACGGTTTCGTCTCACGAGGCTTTATCAGCAAGCCATATT
TTGAAGCCTGGTGTTACATCTGCTTGGATATGGACTAGAGCTCCGACGATTGGAGGTATGAGATTCGCTAGCACGATCACTCTGGGAGAGAAAACTCCGATGAAGGAGGAGGACGCGAAT
CAGAAGAAAACAGAGAACGAATCCACCGGTGGAGACGCCGCCGGAGGTAATAACAAGGGAGATAAAGGAATCGCGAGCTATTGGGGTGTTGAACCTAATAAGATTACTAAAGAAGATGGT
TCTGAATGGAAGTGGAACTGTTTCAGG
GTACGTTATAGCTAGATTCGTATACAGTGTTGTTCTTCGTTGATCTGTGTAAATTTGTTGAAATTTCTTTGGATTTTTGCAGCCATGGGAAAC
GTATAAAGCTGATATAACGATAGATCTGAAGAAGCATCATGTTCCAACGACGTTTCTTGATAGAATAGCTTATTGGACTGTTAAATCTCTTCGTTGGCCTACCGATTTGTTCTTCCAG
GT
ACTGTTCTTCTTCTTCTTCTCCCATGGAAAATTTCTTTACATTTTTTGCCAATTTTATGATATGGAAATGATCCAAATCTGATATCGTCATTGATTACGTGTAACCTTAAATATTTTATT
TCATTCTTTTTATAGCAACTAGTCAATATTTTGTTTGATTATTTTGGAATATATGTGTTTATTATATTAATCACTTCGTTAGTGCTTTGGATTCTTGGTTAATTGTTGGTTAATTATCAT
TATGTAATGAATTATTGGTTAATTGTTGGTCTGATTGTGATATTGTGAATTAAAACAGAGGAGATATGGATGTCGAGCTATGATGCTTGAAACTGTAGCAGCAGTACCTGGAATGGTTGG
AGGAATGTTACTACACTGCAAATCGCTTCGACGTTTTGAGCAAAGTGGAGGATGGATTAAGGCTCTTCTTGAGGAAGCAGAGAATGAGAGAATGCATCTTATGACATTCATGGAAGTCGC
GAAACCGAAATGGTACGAGAGAGCGCTCGTGATCACTGTGCAAGGAGTCTTCTTCAACGCTTATTTCCTTGGTTACTTAATCTCTCCCAAGTTTGCTCATCGTATGGTTGGGTACCTTGA
AGAAGAAGCGATCCATTCTTATACTGAGTTTCTCAAGGAACTTGACAAAGGTAACATTGAGAATGTTCCTGCTCCGGCTATTGCTATTGATTACTGGAGGCTTCCTGCTGATGCGACACT
TCGTGATGTTGTGATGGTTGTTCGTGCTGACGAGGCTCATCACCGTGATGTAAACCATTTTGCATCT
GTAAGTATATTATTTGCTTGAGACTAAATTCTAAAGCTTAAAATCGTGTGTTA
CTGATCAATTATGGTTTTACTTTGTAGGATATTCACTACCAAGGTCGTGAACTAAAGGAAGCTCCAGCTCCAATTGGGTATCATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATAACTCGCGGTGGAGCCAAGGCGGCGAAATCGCTGTTAGTGGCGGCTGGACCACGTTTGTTCTCGACGGTCCGTACGGTTTCGTCTCACGAGGCTTTATCAGCAAGCCATATT
TTGAAGCCTGGTGTTACATCTGCTTGGATATGGACTAGAGCTCCGACGATTGGAGGTATGAGATTCGCTAGCACGATCACTCTGGGAGAGAAAACTCCGATGAAGGAGGAGGACGCGAAT
CAGAAGAAAACAGAGAACGAATCCACCGGTGGAGACGCCGCCGGAGGTAATAACAAGGGAGATAAAGGAATCGCGAGCTATTGGGGTGTTGAACCTAATAAGATTACTAAAGAAGATGGT
TCTGAATGGAAGTGGAACTGTTTCAGG
CCATGGGAAACGTATAAAGCTGATATAACGATAGATCTGAAGAAGCATCATGTTCCAACGACGTTTCTTGATAGAATAGCTTATTGGACTGTT
AAATCTCTTCGTTGGCCTACCGATTTGTTCTTCCAG
AGGAGATATGGATGTCGAGCTATGATGCTTGAAACTGTAGCAGCAGTACCTGGAATGGTTGGAGGAATGTTACTACACTGCAAA
TCGCTTCGACGTTTTGAGCAAAGTGGAGGATGGATTAAGGCTCTTCTTGAGGAAGCAGAGAATGAGAGAATGCATCTTATGACATTCATGGAAGTCGCGAAACCGAAATGGTACGAGAGA
GCGCTCGTGATCACTGTGCAAGGAGTCTTCTTCAACGCTTATTTCCTTGGTTACTTAATCTCTCCCAAGTTTGCTCATCGTATGGTTGGGTACCTTGAAGAAGAAGCGATCCATTCTTAT
ACTGAGTTTCTCAAGGAACTTGACAAAGGTAACATTGAGAATGTTCCTGCTCCGGCTATTGCTATTGATTACTGGAGGCTTCCTGCTGATGCGACACTTCGTGATGTTGTGATGGTTGTT
CGTGCTGACGAGGCTCATCACCGTGATGTAAACCATTTTGCATCT
GATATTCACTACCAAGGTCGTGAACTAAAGGAAGCTCCAGCTCCAATTGGGTATCATTGA

Retrieve as FASTA