Entry information : AtPTOX01 (AT4G22260/IM1/PTOX)
Entry ID 13691
Creation 2016-05-12 (Christophe Dunand)
Last sequence changes 2016-06-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-23 (Christophe Dunand)
Peroxidase information: AtPTOX01 (AT4G22260/IM1/PTOX)
Name (synonym) AtPTOX01 (AT4G22260/IM1/PTOX)
Class Plastid Terminal Oxidase    [Orthogroup: PTOX001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPTOX01
start..stop
S start..stop
ThasPTOX01 558 0 2..351 5..357
HaPTOX03 447 7e-159 3..351 2..333
PpaPTOX02 392 3e-136 53..344 66..374
MpPTOX02 380 6e-132 85..344 89..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 167..315 149 N° 2 447..636 190 N° 3 770..863 94 N° 4 1246..1361 116
N° 5 1449..1557 109 N° 6 1649..1717 69 N° 7 1885..1956 72 N° 8 2058..2105 48
N° 9 2342..2550 209  
join(167..315,447..636,770..863,1246..1361,1449..1557,1649..1717,1885..1956,2058 ..2105,2342..2550)


exon

Literature and cross-references AtPTOX01 (AT4G22260/IM1/PTOX)
Literature Wu, D,Wright, D A,Wetzel, C,Voytas, D F,Rodermel, S The IMMUTANS variegation locus of Arabidopsis defines a mitochondrial alternative oxidase homolog that functions during early chloroplast biogenesis. Plant Cell, 1999
Omic ref. AtProteome:   At4g22260 ATTED-II:   At4g22260 e-FP Browser:   At4g22260 ePlant:   At4g22260 TAIR:   At4g22260
Protein sequence: AtPTOX01 (AT4G22260/IM1/PTOX)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352
PWM (Da):   %s   40548.04 Transmb domain:   %s   i132-154o195-214i
PI (pH):   %s   5.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAISGISSGTLTISRPLVTLRRSRAAVSYSSSHRLLHHLPLSSRRLLLRNNHRVQATILQDDEEKVVVEESFKAETSTGTEPLEEPNMSSSSTSAFETWIIKLEQGVNVFLDSVIKILDTLYRDRTYARFFVLETIARVPYFAFMSVLHMYETFGWWRRADYLKVHFAESWNEMHHLLIMELGGNSWWFDRFLAQHIATFYYFMTVFLYILSPRMAYHFSECVESHAYETYDKFLKASGEELKNMPAPDIAVKYYTGGDLYLFDEFQTSRTPNTRRPVIENLYDVFVNIRDDEAEHCKTMRACQTLGSLRSPHSILEDDDTEEESGCVVPEEAHCEGIVDCLKKSITS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGATTTCAGGCATCTCCTCTGGTACGTTGACGATTTCACGGCCTTTGGTTACTCTTCGACGCTCTAGAGCCGCCGTTTCGTACAGCTCCTCTCACCGATTGCTTCATCATCTT
CCTCTCTCTTCTCGTCGTCTGCTATTAAG
GTGTGCCTAGCTACAGCTAATATTTAATTGATTTGTTCACACGTGATTATGAAAAGGATTTGAATTTTGCTGTACTTTTGTTTCGTCCATT
TCTAGTTTGCTGAAAATTGGAACTTTTTTGAAAACTTCAGGAACAATCATCGAGTCCAAGCAACGATTTTGCAAGACGATGAAGAGAAAGTGGTGGTGGAGGAATCGTTTAAAGCCGAGA
CTTCTACTGGTACAGAACCACTTGAGGAGCCAAATATGAGTTCTTCTTCAACTAGTGCTTTTGAGACATGGATCATCAAGCTTGAGCAAGGAGTGAATGTTTTCCTTACA
GTAAGGTTTT
ATAACTCTTTTATTTACCTGAAACGTTATGTCTTACTAGAAATATAGATTTTTTGGTTGTGTTATTTTACCGGAAGTTATTTCATGTCTTCTGATTGTTGTCTTGTTTTCGTTTTCTCCG
CAGGACTCGGTTATTAAGATACTTGACACTTTGTATCGTGACCGAACATATGCAAGGTTCTTTGTTCTTGAGACAATTGCTAGAGTGCCTTATTTTGGTAAGTGCATCTATTTGTAATTG
TAGTTTCAGTTCGTTATAATATTTGCAAGAAACATTGAGCAGAGCATTAAGAGCTAGTCATTAGGTTTTGTATTCTTCAGAAGACAGTAAGATTGTGAACATCACTTGAGATGTGTGCAG
AAGAAGAACAATGACGAAATAGTTGTGTTTGAGGAATATGTACTCTTTCTTATCTCATTAGAAGCATAGTTCAACTCTTAACAACAAAAGGCGATTCAGTCATCGAGATATTGGATTTGT
TGAGAATCGAATCTTGTTTTTTTTAGTGTGTTTATCACTAATTATGGATCTGGATACCAAATGAAAAGTTGTTCCGAGGCTAGAACATAATGTTTGTTTCTTCTATATGCTCCTTGCAGC
GTTTATGTCTGTGCTACATATGTATGAGACCTTTGGTTGGTGGAGGAGAGCAGATTATTTGAAAGTACACTTTGCTGAGAGCTGGAATGAAATGCATCACTTGCTCATAATGGAA
GTAAG
AACCAAAATGTTACTTCTCTACAAGTTTCATACTCTTTACTCACATAGTTAGTAATAGTAAAACAAATGTTTCTAATCACAGGAATTGGGTGGAAATTCTTGGTGGTTTGATCGTTTTCT
GGCTCAGCACATAGCAACCTTCTACTACTTCATGACAGTGTTCTTGTATATCTTAAGCCCTAGAATGGCAT
GTAAGTTTCCTTTCCGCGTAACTTCTAGAAAGTAGCTGAATAAATTGCT
TCTGGTCTACATGACTTCGTTAACCTTGTGTCACCTATGCAGATCACTTTTCGGAATGTGTGGAGAGTCATGCATATGAGACTTATGATAAATTTCTCAAGGCCAGTGGAGGTTGGTTAC
CAATGGTTTTTTCTTCTTTCTCCACCATTCTGTGTACCATTTACATTAGAACTAAAGTTGTTAATGGAGTTATTGCTTTGAAATATTACACAAAATTCTTCAACGATCTTTACATTCTGA
ATTGTTGTGCTTCATTTTTTTTTGGTTTCCCTAAACAGAGGAGTTGAAGAATATGCCTGCACCGGATATCGCAGTAAAATACTATACGGGAGGTGACTTGTACTTATTTGGTGAGTTTGT
CTTTCCAGGAATTATCAATATCCTCCAGAGTTGTAGAGATGTTTTTACCTATGATTAGTAGTCTTTTAAACTGGCCCTGTATTGTCTGCAGATGAGTTCCAAACATCAAGAACTCCCAAT
ACTCGAAGACCAGTAATAG
GTAGCAAATCTATTTCATATCCGTTTAGTTCTTTCCATCTCTGATTCCGTCGAACCACAAAATGCTAAAAAAAAGTTTATGATTTATCCATGGTTATGATT
CTGCGCTCTATAAATGACTGAGATTCTGTCTTATGTTTGTATGGAGGAAGCATTATTCACAGTTTGTGACTTACTTTGATGTTAAAATAAGAATCTATATAACGTTTTTGTTGTTTTGTG
ATTACGGTTGGGCAGAAAATCTATACGATGTGTTTGTGAACATAAGAGATGATGAAGCAGAACACTGCAAGACAATGAGAGCTTGTCAGACTCTAGGCAGTCTGCGTTCTCCACACTCCA
TTTTAGAAGATGATGATACTGAAGAAGAATCAGGGTGTGTTGTTCCTGAGGAGGCTCATTGCGAAGGTATTGTAGACTGCCTCAAGAAATCCATTACAAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGATTTCAGGCATCTCCTCTGGTACGTTGACGATTTCACGGCCTTTGGTTACTCTTCGACGCTCTAGAGCCGCCGTTTCGTACAGCTCCTCTCACCGATTGCTTCATCATCTT
CCTCTCTCTTCTCGTCGTCTGCTATTAAG
GAACAATCATCGAGTCCAAGCAACGATTTTGCAAGACGATGAAGAGAAAGTGGTGGTGGAGGAATCGTTTAAAGCCGAGACTTCTACTGGT
ACAGAACCACTTGAGGAGCCAAATATGAGTTCTTCTTCAACTAGTGCTTTTGAGACATGGATCATCAAGCTTGAGCAAGGAGTGAATGTTTTCCTTACA
GACTCGGTTATTAAGATACTT
GACACTTTGTATCGTGACCGAACATATGCAAGGTTCTTTGTTCTTGAGACAATTGCTAGAGTGCCTTATTTTG
CGTTTATGTCTGTGCTACATATGTATGAGACCTTTGGTTGGTGGAGG
AGAGCAGATTATTTGAAAGTACACTTTGCTGAGAGCTGGAATGAAATGCATCACTTGCTCATAATGGAA
GAATTGGGTGGAAATTCTTGGTGGTTTGATCGTTTTCTGGCTCAGCACATA
GCAACCTTCTACTACTTCATGACAGTGTTCTTGTATATCTTAAGCCCTAGAATGGCAT
ATCACTTTTCGGAATGTGTGGAGAGTCATGCATATGAGACTTATGATAAATTTCTCAAGGCC
AGTGGAG
AGGAGTTGAAGAATATGCCTGCACCGGATATCGCAGTAAAATACTATACGGGAGGTGACTTGTACTTATTTGATGAGTTCCAAACATCAAGAACTCCCAATACTCGAAGACCA
GTAATAG
AAAATCTATACGATGTGTTTGTGAACATAAGAGATGATGAAGCAGAACACTGCAAGACAATGAGAGCTTGTCAGACTCTAGGCAGTCTGCGTTCTCCACACTCCATTTTAGAA
GATGATGATACTGAAGAAGAATCAGGGTGTGTTGTTCCTGAGGAGGCTCATTGCGAAGGTATTGTAGACTGCCTCAAGAAATCCATTACAAGTTAA

Retrieve as FASTA