Entry information : AtFer03 (AT3G56090/ATFER3/FER3)
Entry ID 13695
Creation 2016-05-12 (Christophe Dunand)
Last sequence changes 2016-07-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-07-04 (Christophe Dunand)
Peroxidase information: AtFer03 (AT3G56090/ATFER3/FER3)
Name (synonym) AtFer03 (AT3G56090/ATFER3/FER3)
Class Ferritin    [Orthogroup: Fer001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtFer03
start..stop
S start..stop
ThasFer01-2 413 3e-148 1..255 1..257
ThasFer01-1 400 7e-143 1..254 1..256
AtFer01 392 6e-140 12..255 17..257
SpolFer02 332 5e-116 47..255 47..255
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..311 311 N° 2 478..561 84 N° 3 654..714 61 N° 4 815..902 88
N° 5 1107..1168 62 N° 6 1271..1336 66 N° 7 1440..1503 64 N° 8 1592..1635 44
join(1..311,478..561,654..714,815..902,1107..1168,1271..1336,1440..1503,1592..16 35)


exon

Literature and cross-references AtFer03 (AT3G56090/ATFER3/FER3)
Omic ref. AtProteome:   At3g56090 ATTED-II:   At3g56090 e-FP Browser:   At3g56090 TAIR:   At3g56090
Protein sequence: AtFer03 (AT3G56090/ATFER3/FER3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   260
PWM (Da):   %s   28818.69  
PI (pH):   %s   5.62
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLKAASTFSLLNIHGEKKDISPLFSSSSSISSPVSSGKSGNLSFPLRASKSSTTTTSTLSGVVFEPFEEVKKEMDLVPSGQQLSLARHLYSPECEAAVNEQINVEYNVSYVYHALYAYFDRDNVALKGLAKFFKESSVEEREHAELLMEYNKRGGRVKLQPMVLPQSEFDHPEKGDALYAMELALSLEKLVNEKLLNLHVASKNDDVQLADFIESVFLNEQVEAIKKISEYVSQLRRLGKGHGTWHFDQELLGAAA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCTCAAAGCTGCTTCTACTTTCTCTCTATTGAACATTCATGGAGAGAAGAAAGACATCTCTCCTCTCTTCTCCTCCTCCTCCTCCATTTCGTCTCCGGTTTCTTCTGGAAAATCC
GGCAATCTCTCTTTCCCTCTTCGTGCTTCCAAGAGTTCAACCACTACCACAAGCACGTTGAGCGGCGTTGTGTTCGAGCCTTTCGAAGAGGTTAAGAAAGAGATGGATCTAGTTCCATCT
GGTCAACAGCTTTCTCTTGCTCGTCATTTGTACTCCCCTGAGTGCGAAGCCGCCGTCAATGAGCAGATCAA
GTACGTTTTTCCGTCTTGGATTGAAACATTTTAGTGATTGTTATCATGG
ATTTGAAAATTGTTATTGTAAATCTGTTGATTGAGTCAATTTTTGCTTGAATCCTATATAGATGAGATTGGCTTTTATTTTGAGTCTCTCATGAATCTGGATTTTCGTTTGATGCAGTGT
TGAGTATAACGTGTCGTATGTGTATCACGCTTTGTATGCATATTTCGATCGTGACAACGTTGCCCTCAAGGGTCTCGCCAA
GTGAGTTTTTCTCTGGTATTGAAATCTCTGTGCTGATAT
TCGTTCTGTGTGATGATGAATTATCTGTTGTTTGGTGTTTTTTGCTGAATCAGGTTTTTCAAGGAATCGAGTGTGGAAGAACGAGAGCACGCTGAGCTGTTGATGGAGTATCAGGTCTTT
GACTAATGATTTCATTTTGTTATCATTCATAAGCCTTATGATCATTTGAGCTAAGTTTGTAACATCTTACATTTTTGGTTTTCTTGATCTACAGAACAAACGTGGTGGGAGGGTCAAGTT
ACAGCCCATGGTGTTGCCTCAGTCTGAGTTTGATCATCCTGAGAAAGGAGATGCTCTCTATG
GTAAGCTTCATTTCCATTTCTGAGATTTTAGATAAAGAATTCCAGTACAAAGTATCTG
TAGTTTCTTAAGACTTCAGAGTTGACATACATGTGATGTTATTAGTGAAGAGGAGGATTGTTGGGTCTCAGTAGGATCTAATATAGTGATTGTGTTGAGTTTTAAGATTGGAAAGCTTAA
TTTCATGTTGATTGTTGTTTTTGCAGCTATGGAGTTGGCTCTTTCATTGGAGAAACTAGTCAATGAAAAGCTCCTAAACCTGCACAGTGTAAGACCATCTCTCTCATTAGGATCCAGTTC
TTGTTTATGGTATTCAAGTCATAATCTAGTTTCTTAATACAACTTGGTATTTGAATAATGTGGTCAACAGGTGGCTTCCAAGAACGATGATGTCCAGTTGGCAGATTTTATTGAGAGTGT
GTTTCTGAACGAACAG
GTAAAACAAAAGACCTACACGTTCTATGTTAGTGGCAAAGATATGGGGTTCTTGATCTGTCAAAAATGGAATCTAATGAAGTTTAATTAACATCACTTTGCAGG
TGGAAGCCATTAAGAAAATCTCAGAATATGTTTCTCAACTTAGGAGACTTGGCAAAGGACATG
GTAACCATTTGTTTATTCAATTTAAAACTAATAAAACACACCTCAATTCGTCCACTT
CGTGTCTTACACTTTGTTTATTTGTAATCAGGAACATGGCATTTCGATCAGGAGCTTCTTGGTGCTGCTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCTCAAAGCTGCTTCTACTTTCTCTCTATTGAACATTCATGGAGAGAAGAAAGACATCTCTCCTCTCTTCTCCTCCTCCTCCTCCATTTCGTCTCCGGTTTCTTCTGGAAAATCC
GGCAATCTCTCTTTCCCTCTTCGTGCTTCCAAGAGTTCAACCACTACCACAAGCACGTTGAGCGGCGTTGTGTTCGAGCCTTTCGAAGAGGTTAAGAAAGAGATGGATCTAGTTCCATCT
GGTCAACAGCTTTCTCTTGCTCGTCATTTGTACTCCCCTGAGTGCGAAGCCGCCGTCAATGAGCAGATCAA
TGTTGAGTATAACGTGTCGTATGTGTATCACGCTTTGTATGCATATTTC
GATCGTGACAACGTTGCCCTCAAGGGTCTCGCCAA
GTTTTTCAAGGAATCGAGTGTGGAAGAACGAGAGCACGCTGAGCTGTTGATGGAGTATCAGAACAAACGTGGTGGGAGGGTCAAG
TTACAGCCCATGGTGTTGCCTCAGTCTGAGTTTGATCATCCTGAGAAAGGAGATGCTCTCTATG
CTATGGAGTTGGCTCTTTCATTGGAGAAACTAGTCAATGAAAAGCTCCTAAACCTG
CACAGT
GTGGCTTCCAAGAACGATGATGTCCAGTTGGCAGATTTTATTGAGAGTGTGTTTCTGAACGAACAGGTGGAAGCCATTAAGAAAATCTCAGAATATGTTTCTCAACTTAGGAGA
CTTGGCAAAGGACATG
GAACATGGCATTTCGATCAGGAGCTTCTTGGTGCTGCTGCTTAA

Retrieve as FASTA